Id: | acc1695 |
Group: | 2sens |
Protein: | ERK2 |
Gene Symbol: | MAPK1 |
Protein Id: | P28482 |
Protein Name: | MK01_HUMAN |
PTM: | phosphorylation |
Site: | Tyr187 |
Site Sequence: | HDHTGFLTEYVATRWYRAPEI |
Disease Category: | Cancer |
Disease: | Stomach Cancer |
Disease Subtype: | |
Disease Cellline: | |
Disease Info: | |
Drug: | Vitamin K3 |
Drug Info: | Vitamin K3 (Menadione) is a synthetic form of vitamin K that acts as a cofactor for the synthesis of blood clotting factors and is used as a hemostatic agent and nutritional supplement in both medical and veterinary applications. |
Relation: |
Vitamin K3
➜
ERK2-Tyr187
UP
➜
Stomach Cancer
Aggravate
|
Effect: | modulate |
Effect Info: | Vitamin K3 (VK3) induces cancer cell growth inhibition and ERK phosphorylation through specific pathways. |
Note: | |
Score: | 4.0 |
Pubmed(PMID): | 12678906 |
Sentence Index: | 12678906_2-3 |
Sentence: | "Since it was found that Vitamin K3 (VK3) or its analog was a potent growth inhibitor and inducer for ERK phosphorylation through specific pathway in cancer cell line, the critical role of ERK phosphorylation in growth inhibitory actions can be discussed. VK3 induced receptor tyrosine phosphorylation and occurred at growth inhibitory concentrations." |
Sequence & Structure:
MAAAAAAGAGPEMVRGQVFDVGPRYTNLSYIGEGAYGMVCSAYDNVNKVRVAIKKISPFEHQTYCQRTLREIKILLRFRHENIIGINDIIRAPTIEQMKDVYIVQDLMETDLYKLLKTQHLSNDHICYFLYQILRGLKYIHSANVLHRDLKPSNLLLNTTCDLKICDFGLARVADPDHDHTGFLTEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEMLSNRPIFPGKHYLDQLNHILGILGSPSQEDLNCIINLKARNYLLSLPHKNKVPWNRLFPNADSKALDLLDKMLTFNPHKRIEVEQALAHPYLEQYYDPSDEPIAEAPFKFDMELDDLPKEKLKELIFEETARFQPGYRS
Select PDB:
Target | Drug name | MOA | Phase | Status | Disease | Source |
---|---|---|---|---|---|---|
MAPK1 | ULIXERTINIB | MAP kinase ERK2 inhibitor | 2 | Terminated | neoplasm | ClinicalTrials |
MAPK1 | TEMUTERKIB | Mitogen-activated protein kinase; ERK1/ERK2 inhibitor | 2 | Completed | pancreatic carcinoma | ClinicalTrials |
MAPK1 | ULIXERTINIB | MAP kinase ERK2 inhibitor | 2 | Recruiting | histiocytic neoplasm | ClinicalTrials |
MAPK1 | ULIXERTINIB | MAP kinase ERK2 inhibitor | 2 | Active, not recruiting | Uveal Melanoma | ClinicalTrials |
MAPK1 | TEMUTERKIB | Mitogen-activated protein kinase; ERK1/ERK2 inhibitor | 2 | Terminated | cancer | ClinicalTrials |
MAPK1 | ULIXERTINIB | MAP kinase ERK2 inhibitor | 1 | Completed | acute myeloid leukemia | ClinicalTrials |
MAPK1 | ULIXERTINIB | MAP kinase ERK2 inhibitor | 1 | Completed | myelodysplastic syndrome | ClinicalTrials |
MAPK1 | TEMUTERKIB | Mitogen-activated protein kinase; ERK1/ERK2 inhibitor | 1 | Recruiting | acute myeloid leukemia | ClinicalTrials |
MAPK1 | ULIXERTINIB | MAP kinase ERK2 inhibitor | 1 | Completed | neoplasm | ClinicalTrials ClinicalTrials |
MAPK1 | MK-8353 | MAP kinase ERK2 inhibitor | 1 | Completed | neoplasm | ClinicalTrials |
MAPK1 | RAVOXERTINIB | MAP kinase ERK2 inhibitor | 1 | Completed | neoplasm | ClinicalTrials |
MAPK1 | MK-8353 | MAP kinase ERK2 inhibitor | 1 | Terminated | neoplasm | ClinicalTrials |
MAPK1 | ULIXERTINIB | MAP kinase ERK2 inhibitor | 1 | Recruiting | pancreatic carcinoma | ClinicalTrials |
MAPK1 | ULIXERTINIB | MAP kinase ERK2 inhibitor | 1 | Terminated | pancreatic carcinoma | ClinicalTrials |
MAPK1 | ULIXERTINIB | MAP kinase ERK2 inhibitor | 1 | Recruiting | metastatic colorectal cancer | ClinicalTrials |
MAPK1 | KO-947 | Mitogen-activated protein kinase; ERK1/ERK2 inhibitor | 1 | Terminated | cancer | ClinicalTrials |
MAPK1 | MK-8353 | MAP kinase ERK2 inhibitor | 1 | Completed | colorectal cancer | ClinicalTrials |
MAPK1 | TEMUTERKIB | Mitogen-activated protein kinase; ERK1/ERK2 inhibitor | 0.5 | Recruiting | glioblastoma multiforme | ClinicalTrials |
MAPK1 | ULIXERTINIB | MAP kinase ERK2 inhibitor | 0.5 | Recruiting | Paraganglioma | ClinicalTrials |
Note: Only show clinically investigational or approved drugs with protein targets.
Protein Tractability:
source: Open TargetsPTM Intensity:
source: CPTACMAPK1-Tyr187 | |
---|---|
Cancer | Intensity |
BRCA | 0.772 |
COAD | 0.273 |
HGSC | 0.701 |
ccRCC | -0.806 |
GBM | 0.279 |
HNSC | 0.328 |
LUAD | 0.387 |
LUSC | 0.866 |
non_ccRCC | -2.593 |
PDAC | 0.32 |
UCEC | -0.527 |
PTM-Disease Association:
source: PTMDResidue | Position | State | Disease | Class | PMID |
---|---|---|---|---|---|
Y | 187 | U | Thyroid cancer/carcinoma | Phosphorylation | 17209045 |
Y | 187 | U | Triple-negative breast cancer | Phosphorylation | 28415597 |
State Note: Based on the distinct PTM states in diseases, PTMD classified all disease-associated PTMs into six classes, including whether the up-regulation (U) or down-regulation (D) of PTM levels, the absence (A) or presence (P) of PTMs, and the creation (C) or disruption (N) of PTM sites are associated with diseases.
PTM-Drug Perturbation Response:
source: DecryptMProtein | Gene | PTM | Position | Modified sequence | Cell | Drug | pEC50 | Regulation | Experiment |
---|---|---|---|---|---|---|---|---|---|
P28482 | MAPK1 | P | Tyr187 | VADPDHDHTGFLTEY(ph)VATR | A431 | Imatinib | 5.4775 | up | |
P28482 | MAPK1 | P | Tyr187 | VADPDHDHTGFLTEY(ph)VATR | BT-474 | Lapatinib | 6.6172 | down | |
P28482 | MAPK1 | P | Tyr187 | VADPDHDHTGFLTEY(ph)VATR | K562 | Dasatinib | 8.8776 | down | |
P28482 | MAPK1 | P | Tyr187 | VADPDHDHTGFLTEY(ph)VATR | KYSE-520 | SHP099 | 6.2002 | down | |
P28482 | MAPK1 | P | Tyr187 | VADPDHDHTGFLTEY(ph)VATR | MDA-MB-175 | Lapatinib | 7.3646 | down | |
P28482 | MAPK1 | P | Tyr187 | VADPDHDHTGFLTEY(ph)VATR | MDA-MB-175 | Pertuzumab | -4.632 | down | |
P28482 | MAPK1 | P | Tyr187 | VADPDHDHTGFLTEY(ph)VATR | PC-9 | LapatinibAZD4547 | 6.4194 | down | |
P28482 | MAPK1 | P | Tyr187 | VADPDHDHTGFLTEY(ph)VATR | PC-9 | Lapatinib | 6.4558 | down | |
P28482 | MAPK1 | P | Thr185;Tyr187 | VADPDHDHTGFLT(ph)EY(ph)VATR | SK-BR-3 | Trastuzumab | -1.2287 | - | |
P28482 | MAPK1 | P | Tyr187 | VADPDHDHTGFLTEY(ph)VATR | A431 | Dasatinib | 6.1777 | - | |
P28482 | MAPK1 | P | Tyr187 | VADPDHDHTGFLTEY(ph)VATR | SK-BR-3 | Trastuzumab | -0.81 | - | |
P28482 | MAPK1 | P | Tyr187 | VADPDHDHTGFLTEY(ph)VATR | SK-BR-3 | Pertuzumab | -1.7704 | - | |
P28482 | MAPK1 | P | Tyr187 | VADPDHDHTGFLTEY(ph)VATR | SK-BR-3 | Lapatinib | 4.7218 | - | |
P28482 | MAPK1 | P | Tyr187;Thr190 | VADPDHDHTGFLTEY(ph)VAT(ph)R | PC-9 | AZD4547 | 1.938 | - | |
P28482 | MAPK1 | P | Tyr187 | VADPDHDHTGFLTEY(ph)VATR | PC-9 | AZD4547 | 7.196 | - | |
P28482 | MAPK1 | P | Thr185;Tyr187 | VADPDHDHTGFLT(ph)EY(ph)VATR | PC-9 | AZD4547 | 7.2923 | - | |
P28482 | MAPK1 | P | Thr185;Tyr187 | VADPDHDHTGFLT(ph)EY(ph)VATR | MDA-MB-175 | Trastuzumab | -1.6811 | - | |
P28482 | MAPK1 | P | Tyr187 | VADPDHDHTGFLTEY(ph)VATR | MDA-MB-175 | Trastuzumab | 5 | - | |
P28482 | MAPK1 | P | Tyr187 | VADPDHDHTGFLTEY(ph)VATR | K562 | Imatinib | 7.13 | - | |
P28482 | MAPK1 | P | Tyr187 | VADPDHDHTGFLTEY(ph)VATR | BT-474 | Trastuzumab | -2.1745 | - | |
P28482 | MAPK1 | P | Tyr187 | VADPDHDHTGFLTEY(ph)VATR | BT-474 | Pertuzumab | -1.9633 | - |
pEC50 Note: pEC50 is the negative logarithm of EC50 (half-maximal effective concentration, dosage unit Mol), calculated as pEC50 = -log10(EC50), which quantifies the potency of a drug or compound.
Function score:
source: funscoRNo data.