Id: | acc1579 |
Group: | 2sens |
Protein: | YB-1 |
Gene Symbol: | YAP1 |
Protein Id: | P46937 |
Protein Name: | YAP1_HUMAN |
PTM: | phosphorylation |
Site: | Ser102 |
Site Sequence: | DSFFKPPEPKSHSRQASTDAG |
Disease Category: | Cancer |
Disease: | Hepatocellular Carcinoma |
Disease Subtype: | |
Disease Cellline: | HuH-7R(sorafenib-resistant) |
Disease Info: | |
Drug: | Sorafenib |
Drug Info: | "Sorafenib is a multikinase inhibitor that targets Raf kinases, vascular endothelial growth factor receptors (VEGFR), platelet-derived growth factor receptor (PDGFR), and other kinases, primarily used in the treatment of advanced renal cell carcinoma, unresectable hepatocellular carcinoma, and radioactive iodine-refractory differentiated thyroid cancer." |
Relation: |
Sorafenib
➜
YB-1-Ser102
UP
➜
Hepatocellular Carcinoma
Aggravate
|
Effect: | modulate |
Effect Info: | "Sorafenib promotes the phosphorylation of YB-1 through the action of the EGFR/PI3K/AKT pathway, resulting in a significant enhancement of the metastasis of hepatocellular carcinoma (HCC) cells." |
Note: | |
Score: | 4.0 |
Pubmed(PMID): | 33379356 |
Sentence Index: | 33379356_9-10 |
Sentence: | "Mutation analyses revealed that phosphorylation at S102 affects the migratory and invasive potential of HuH-7R cells. Our collective findings suggest that sorafenib promotes YB-1 phosphorylation through effect from the EGFR/PI3K/AKT pathway, leading to significant enhancement of hepatocellular carcinoma (HCC) cell metastasis." |
Sequence & Structure:
MDPGQQPPPQPAPQGQGQPPSQPPQGQGPPSGPGQPAPAATQAAPQAPPAGHQIVHVRGDSETDLEALFNAVMNPKTANVPQTVPMRLRKLPDSFFKPPEPKSHSRQASTDAGTAGALTPQHVRAHSSPASLQLGAVSPGTLTPTGVVSGPAATPTAQHLRQSSFEIPDDVPLPAGWEMAKTSSGQRYFLNHIDQTTTWQDPRKAMLSQMNVTAPTSPPVQQNMMNSASGPLPDGWEQAMTQDGEIYYINHKNKTTSWLDPRLDPRFAMNQRISQSAPVKQPPPLAPQSPQGGVMGGSNSNQQQQMRLQQLQMEKERLRLKQQELLRQAMRNINPSTANSPKCQELALRSQLPTLEQDGGTQNPVSSPGMSQELRTMTTNSSDPFLNSGTYHSRDESTDSGLSMSSYSVPRTPDDFLNSVDEMDTGDTINQSTLPSQQNRFPDYLEAIPGTNVDLGTLEGDGMNIEGEELMPSLQEALSSDILNDMESVLAATKLDKESFLTWL
Select PDB:
No data.
Protein Tractability:
source: Open TargetsPTM Intensity:
source: CPTACNo intensity data of this site,
show all other sites!
SYAP1-Ser269 | |||||
---|---|---|---|---|---|
Cancer | Intensity | ||||
BRCA | |||||
COAD | 0.546 | ||||
HGSC | -1.783 | ||||
ccRCC | 0.322 | ||||
GBM | |||||
HNSC | 0.436 | ||||
LUAD | 0.479 | ||||
LUSC | |||||
non_ccRCC | |||||
PDAC | |||||
UCEC |
SYAP1-Ser273 | |||||
---|---|---|---|---|---|
Cancer | Intensity | ||||
BRCA | |||||
COAD | 0.706 | ||||
HGSC | -1.383 | ||||
ccRCC | 0.763 | ||||
GBM | |||||
HNSC | -0.087 | ||||
LUAD | |||||
LUSC | |||||
non_ccRCC | |||||
PDAC | |||||
UCEC |
SYAP1-Ser277 | |||||
---|---|---|---|---|---|
Cancer | Intensity | ||||
BRCA | -0.803 | ||||
COAD | |||||
HGSC | |||||
ccRCC | |||||
GBM | |||||
HNSC | 1.12 | ||||
LUAD | |||||
LUSC | -0.318 | ||||
non_ccRCC | |||||
PDAC | |||||
UCEC |
SYAP1-Ser313 | |||||
---|---|---|---|---|---|
Cancer | Intensity | ||||
BRCA | -0.445 | ||||
COAD | 0.548 | ||||
HGSC | -0.003 | ||||
ccRCC | -0.25 | ||||
GBM | 0.357 | ||||
HNSC | 0.012 | ||||
LUAD | -2.227 | ||||
LUSC | -1.047 | ||||
non_ccRCC | 1.217 | ||||
PDAC | 0.718 | ||||
UCEC | 1.122 |
SYAP1-Ser86 | |||||
---|---|---|---|---|---|
Cancer | Intensity | ||||
BRCA | -0.645 | ||||
COAD | |||||
HGSC | |||||
ccRCC | |||||
GBM | |||||
HNSC | |||||
LUAD | -0.507 | ||||
LUSC | 1.152 | ||||
non_ccRCC | |||||
PDAC | |||||
UCEC |
SYAP1-Thr248 | |||||
---|---|---|---|---|---|
Cancer | Intensity | ||||
BRCA | -1.26 | ||||
COAD | -0.662 | ||||
HGSC | 2.336 | ||||
ccRCC | 0.03 | ||||
GBM | -0.117 | ||||
HNSC | 0.671 | ||||
LUAD | -1.071 | ||||
LUSC | -0.124 | ||||
non_ccRCC | 0.826 | ||||
PDAC | -0.241 | ||||
UCEC | -0.387 |
SYAP1-Thr268 | |||||
---|---|---|---|---|---|
Cancer | Intensity | ||||
BRCA | |||||
COAD | |||||
HGSC | |||||
ccRCC | -0.928 | ||||
GBM | |||||
HNSC | -0.131 | ||||
LUAD | 1.059 | ||||
LUSC | |||||
non_ccRCC | |||||
PDAC | |||||
UCEC |
SYAP1-Thr306 | |||||
---|---|---|---|---|---|
Cancer | Intensity | ||||
BRCA | |||||
COAD | |||||
HGSC | |||||
ccRCC | 0.128 | ||||
GBM | |||||
HNSC | 0.93 | ||||
LUAD | -1.058 | ||||
LUSC | |||||
non_ccRCC | |||||
PDAC | |||||
UCEC |
YAP1-Ser109 | |||||
---|---|---|---|---|---|
Cancer | Intensity | ||||
BRCA | |||||
COAD | 1.042 | ||||
HGSC | 1.185 | ||||
ccRCC | 0.213 | ||||
GBM | -1.567 | ||||
HNSC | -0.973 | ||||
LUAD | 0.219 | ||||
LUSC | |||||
non_ccRCC | |||||
PDAC | |||||
UCEC | -0.12 |
YAP1-Ser127 | |||||
---|---|---|---|---|---|
Cancer | Intensity | ||||
BRCA | |||||
COAD | 0.729 | ||||
HGSC | -1.387 | ||||
ccRCC | |||||
GBM | |||||
HNSC | 0.735 | ||||
LUAD | -0.077 | ||||
LUSC | |||||
non_ccRCC | |||||
PDAC | |||||
UCEC |
YAP1-Ser128 | |||||
---|---|---|---|---|---|
Cancer | Intensity | ||||
BRCA | |||||
COAD | 0.451 | ||||
HGSC | -1.369 | ||||
ccRCC | |||||
GBM | |||||
HNSC | 0.959 | ||||
LUAD | -0.042 | ||||
LUSC | |||||
non_ccRCC | |||||
PDAC | |||||
UCEC |
YAP1-Ser131 | |||||
---|---|---|---|---|---|
Cancer | Intensity | ||||
BRCA | |||||
COAD | 0.707 | ||||
HGSC | -0.707 | ||||
ccRCC | |||||
GBM | |||||
HNSC | |||||
LUAD | |||||
LUSC | |||||
non_ccRCC | |||||
PDAC | |||||
UCEC |
YAP1-Ser138 | |||||
---|---|---|---|---|---|
Cancer | Intensity | ||||
BRCA | |||||
COAD | 0.516 | ||||
HGSC | -1.439 | ||||
ccRCC | |||||
GBM | |||||
HNSC | 0.807 | ||||
LUAD | 0.116 | ||||
LUSC | |||||
non_ccRCC | |||||
PDAC | |||||
UCEC |
YAP1-Ser164 | |||||
---|---|---|---|---|---|
Cancer | Intensity | ||||
BRCA | |||||
COAD | -0.707 | ||||
HGSC | 0.707 | ||||
ccRCC | |||||
GBM | |||||
HNSC | |||||
LUAD | |||||
LUSC | |||||
non_ccRCC | |||||
PDAC | |||||
UCEC |
YAP1-Ser236 | |||||
---|---|---|---|---|---|
Cancer | Intensity | ||||
BRCA | -1.426 | ||||
COAD | |||||
HGSC | |||||
ccRCC | 1.534 | ||||
GBM | |||||
HNSC | 0.544 | ||||
LUAD | 0 | ||||
LUSC | 0.453 | ||||
non_ccRCC | |||||
PDAC | -0.051 | ||||
UCEC | -1.054 |
YAP1-Ser238 | |||||
---|---|---|---|---|---|
Cancer | Intensity | ||||
BRCA | 0.915 | ||||
COAD | |||||
HGSC | |||||
ccRCC | 0.555 | ||||
GBM | 1.534 | ||||
HNSC | -1.115 | ||||
LUAD | -0.302 | ||||
LUSC | -0.889 | ||||
non_ccRCC | |||||
PDAC | 0.404 | ||||
UCEC | -1.103 |
YAP1-Ser251 | |||||
---|---|---|---|---|---|
Cancer | Intensity | ||||
BRCA | -1.348 | ||||
COAD | |||||
HGSC | |||||
ccRCC | -0.815 | ||||
GBM | 0.388 | ||||
HNSC | -0.026 | ||||
LUAD | -0.301 | ||||
LUSC | 1.708 | ||||
non_ccRCC | |||||
PDAC | -0.603 | ||||
UCEC | 0.997 |
YAP1-Ser260 | |||||
---|---|---|---|---|---|
Cancer | Intensity | ||||
BRCA | |||||
COAD | |||||
HGSC | |||||
ccRCC | 1.067 | ||||
GBM | -0.151 | ||||
HNSC | |||||
LUAD | -0.916 | ||||
LUSC | |||||
non_ccRCC | |||||
PDAC | |||||
UCEC |
YAP1-Ser274 | |||||
---|---|---|---|---|---|
Cancer | Intensity | ||||
BRCA | |||||
COAD | 0.896 | ||||
HGSC | -1.079 | ||||
ccRCC | |||||
GBM | |||||
HNSC | |||||
LUAD | |||||
LUSC | |||||
non_ccRCC | 0.183 | ||||
PDAC | |||||
UCEC |
YAP1-Ser276 | |||||
---|---|---|---|---|---|
Cancer | Intensity | ||||
BRCA | |||||
COAD | 0.498 | ||||
HGSC | -1.151 | ||||
ccRCC | |||||
GBM | |||||
HNSC | |||||
LUAD | |||||
LUSC | |||||
non_ccRCC | 0.654 | ||||
PDAC | |||||
UCEC |
YAP1-Ser289 | |||||
---|---|---|---|---|---|
Cancer | Intensity | ||||
BRCA | |||||
COAD | 0.839 | ||||
HGSC | -1.107 | ||||
ccRCC | |||||
GBM | |||||
HNSC | |||||
LUAD | |||||
LUSC | |||||
non_ccRCC | 0.268 | ||||
PDAC | |||||
UCEC |
YAP1-Ser298 | |||||
---|---|---|---|---|---|
Cancer | Intensity | ||||
BRCA | |||||
COAD | |||||
HGSC | -1.717 | ||||
ccRCC | 0.735 | ||||
GBM | |||||
HNSC | -0.013 | ||||
LUAD | 0.405 | ||||
LUSC | |||||
non_ccRCC | |||||
PDAC | |||||
UCEC | 0.59 |
YAP1-Ser302 | |||||
---|---|---|---|---|---|
Cancer | Intensity | ||||
BRCA | 2.035 | ||||
COAD | |||||
HGSC | |||||
ccRCC | |||||
GBM | -0.317 | ||||
HNSC | -0.496 | ||||
LUAD | -0.455 | ||||
LUSC | |||||
non_ccRCC | |||||
PDAC | -0.317 | ||||
UCEC | -0.45 |
YAP1-Ser328 | |||||
---|---|---|---|---|---|
Cancer | Intensity | ||||
BRCA | |||||
COAD | |||||
HGSC | |||||
ccRCC | -1.49 | ||||
GBM | |||||
HNSC | 0.654 | ||||
LUAD | 0.39 | ||||
LUSC | |||||
non_ccRCC | |||||
PDAC | |||||
UCEC | 0.447 |
YAP1-Ser329 | |||||
---|---|---|---|---|---|
Cancer | Intensity | ||||
BRCA | 2.2 | ||||
COAD | |||||
HGSC | |||||
ccRCC | |||||
GBM | 0.044 | ||||
HNSC | -0.19 | ||||
LUAD | -0.502 | ||||
LUSC | -0.36 | ||||
non_ccRCC | |||||
PDAC | -0.471 | ||||
UCEC | -0.721 |
YAP1-Ser333 | |||||
---|---|---|---|---|---|
Cancer | Intensity | ||||
BRCA | -0.047 | ||||
COAD | |||||
HGSC | |||||
ccRCC | |||||
GBM | -0.546 | ||||
HNSC | 2.211 | ||||
LUAD | -0.425 | ||||
LUSC | -0.652 | ||||
non_ccRCC | |||||
PDAC | -0.098 | ||||
UCEC | -0.443 |
YAP1-Ser340 | |||||
---|---|---|---|---|---|
Cancer | Intensity | ||||
BRCA | |||||
COAD | 0.142 | ||||
HGSC | -1.063 | ||||
ccRCC | |||||
GBM | |||||
HNSC | |||||
LUAD | |||||
LUSC | |||||
non_ccRCC | 0.922 | ||||
PDAC | |||||
UCEC |
YAP1-Ser344 | |||||
---|---|---|---|---|---|
Cancer | Intensity | ||||
BRCA | |||||
COAD | |||||
HGSC | |||||
ccRCC | -0.685 | ||||
GBM | |||||
HNSC | 0.248 | ||||
LUAD | -0.871 | ||||
LUSC | |||||
non_ccRCC | |||||
PDAC | |||||
UCEC | 1.308 |
YAP1-Ser350 | |||||
---|---|---|---|---|---|
Cancer | Intensity | ||||
BRCA | 1.258 | ||||
COAD | |||||
HGSC | |||||
ccRCC | |||||
GBM | |||||
HNSC | |||||
LUAD | -0.4 | ||||
LUSC | 0.238 | ||||
non_ccRCC | |||||
PDAC | |||||
UCEC | -1.096 |
YAP1-Ser359 | |||||
---|---|---|---|---|---|
Cancer | Intensity | ||||
BRCA | -0.707 | ||||
COAD | |||||
HGSC | |||||
ccRCC | |||||
GBM | |||||
HNSC | 0.707 | ||||
LUAD | |||||
LUSC | |||||
non_ccRCC | |||||
PDAC | |||||
UCEC |
YAP1-Ser362 | |||||
---|---|---|---|---|---|
Cancer | Intensity | ||||
BRCA | 0.299 | ||||
COAD | |||||
HGSC | |||||
ccRCC | -0.674 | ||||
GBM | |||||
HNSC | -0.076 | ||||
LUAD | -0.958 | ||||
LUSC | -0.231 | ||||
non_ccRCC | |||||
PDAC | 2.072 | ||||
UCEC | -0.432 |
YAP1-Ser366 | |||||
---|---|---|---|---|---|
Cancer | Intensity | ||||
BRCA | |||||
COAD | 0.707 | ||||
HGSC | -0.707 | ||||
ccRCC | |||||
GBM | |||||
HNSC | |||||
LUAD | |||||
LUSC | |||||
non_ccRCC | |||||
PDAC | |||||
UCEC |
YAP1-Ser367 | |||||
---|---|---|---|---|---|
Cancer | Intensity | ||||
BRCA | |||||
COAD | 0.86 | ||||
HGSC | -0.88 | ||||
ccRCC | |||||
GBM | |||||
HNSC | |||||
LUAD | -0.852 | ||||
LUSC | |||||
non_ccRCC | 0.872 | ||||
PDAC | |||||
UCEC |
YAP1-Ser371 | |||||
---|---|---|---|---|---|
Cancer | Intensity | ||||
BRCA | |||||
COAD | |||||
HGSC | -0.707 | ||||
ccRCC | |||||
GBM | |||||
HNSC | |||||
LUAD | |||||
LUSC | |||||
non_ccRCC | 0.707 | ||||
PDAC | |||||
UCEC |
YAP1-Ser382 | |||||
---|---|---|---|---|---|
Cancer | Intensity | ||||
BRCA | |||||
COAD | 0.707 | ||||
HGSC | -0.707 | ||||
ccRCC | |||||
GBM | |||||
HNSC | |||||
LUAD | |||||
LUSC | |||||
non_ccRCC | |||||
PDAC | |||||
UCEC |
YAP1-Ser419 | |||||
---|---|---|---|---|---|
Cancer | Intensity | ||||
BRCA | |||||
COAD | 0.707 | ||||
HGSC | -0.707 | ||||
ccRCC | |||||
GBM | |||||
HNSC | |||||
LUAD | |||||
LUSC | |||||
non_ccRCC | |||||
PDAC | |||||
UCEC |
YAP1-Ser61 | |||||
---|---|---|---|---|---|
Cancer | Intensity | ||||
BRCA | 0.161 | ||||
COAD | 0.451 | ||||
HGSC | -2.521 | ||||
ccRCC | 0.324 | ||||
GBM | -0.207 | ||||
HNSC | 0.309 | ||||
LUAD | 0.558 | ||||
LUSC | 0.368 | ||||
non_ccRCC | 0.895 | ||||
PDAC | 0.797 | ||||
UCEC | -1.135 |
YAP1-Ser94 | |||||
---|---|---|---|---|---|
Cancer | Intensity | ||||
BRCA | -0.163 | ||||
COAD | |||||
HGSC | |||||
ccRCC | |||||
GBM | |||||
HNSC | -1.282 | ||||
LUAD | |||||
LUSC | 0.263 | ||||
non_ccRCC | 0.77 | ||||
PDAC | -0.93 | ||||
UCEC | 1.343 |
YAP1-Thr110 | |||||
---|---|---|---|---|---|
Cancer | Intensity | ||||
BRCA | 0.228 | ||||
COAD | -0.096 | ||||
HGSC | -1.953 | ||||
ccRCC | |||||
GBM | |||||
HNSC | 0.722 | ||||
LUAD | 0.543 | ||||
LUSC | 0.556 | ||||
non_ccRCC | |||||
PDAC | |||||
UCEC |
YAP1-Thr114 | |||||
---|---|---|---|---|---|
Cancer | Intensity | ||||
BRCA | 0.379 | ||||
COAD | |||||
HGSC | |||||
ccRCC | 0.153 | ||||
GBM | |||||
HNSC | -0.393 | ||||
LUAD | -0.582 | ||||
LUSC | 1.678 | ||||
non_ccRCC | |||||
PDAC | |||||
UCEC | -1.234 |
YAP1-Thr119 | |||||
---|---|---|---|---|---|
Cancer | Intensity | ||||
BRCA | |||||
COAD | 0.1 | ||||
HGSC | -0.905 | ||||
ccRCC | |||||
GBM | 0.423 | ||||
HNSC | |||||
LUAD | -1.006 | ||||
LUSC | -0.98 | ||||
non_ccRCC | |||||
PDAC | 1.513 | ||||
UCEC | 0.854 |
YAP1-Thr141 | |||||
---|---|---|---|---|---|
Cancer | Intensity | ||||
BRCA | |||||
COAD | |||||
HGSC | -1.15 | ||||
ccRCC | |||||
GBM | |||||
HNSC | 0.669 | ||||
LUAD | 0.481 | ||||
LUSC | |||||
non_ccRCC | |||||
PDAC | |||||
UCEC |
YAP1-Thr143 | |||||
---|---|---|---|---|---|
Cancer | Intensity | ||||
BRCA | |||||
COAD | |||||
HGSC | 1.057 | ||||
ccRCC | |||||
GBM | |||||
HNSC | -0.125 | ||||
LUAD | -0.931 | ||||
LUSC | |||||
non_ccRCC | |||||
PDAC | |||||
UCEC |
YAP1-Thr299 | |||||
---|---|---|---|---|---|
Cancer | Intensity | ||||
BRCA | |||||
COAD | |||||
HGSC | |||||
ccRCC | 0.637 | ||||
GBM | |||||
HNSC | -1.492 | ||||
LUAD | 0.391 | ||||
LUSC | |||||
non_ccRCC | |||||
PDAC | |||||
UCEC | 0.464 |
YAP1-Thr323 | |||||
---|---|---|---|---|---|
Cancer | Intensity | ||||
BRCA | |||||
COAD | |||||
HGSC | |||||
ccRCC | -1.152 | ||||
GBM | |||||
HNSC | 0.646 | ||||
LUAD | 0.506 | ||||
LUSC | |||||
non_ccRCC | |||||
PDAC | |||||
UCEC |
YAP1-Thr374 | |||||
---|---|---|---|---|---|
Cancer | Intensity | ||||
BRCA | |||||
COAD | |||||
HGSC | |||||
ccRCC | |||||
GBM | |||||
HNSC | |||||
LUAD | -0.931 | ||||
LUSC | 1.057 | ||||
non_ccRCC | |||||
PDAC | |||||
UCEC | -0.126 |
YAP1-Thr63 | |
---|---|
Cancer | Intensity |
BRCA | |
COAD | 0.399 |
HGSC | -2.199 |
ccRCC | 0.539 |
GBM | -0.045 |
HNSC | 0.651 |
LUAD | 0.519 |
LUSC | |
non_ccRCC | |
PDAC | |
UCEC | 0.136 |
PTM-Disease Association:
source: PTMDResidue | Position | State | Disease | Class | PMID |
---|---|---|---|---|---|
S | 127 | A | Hepatocellular carcinoma/hepatocarcinoma/hepatoma | Phosphorylation | 22761457 |
- | - | A | Esophageal squamous cell carcinoma | Ubiquitination | 31884247 |
S | 381 | A | Adult T-cell leukemia/lymphoma | Phosphorylation | 35210364 |
S | 127 | A | Adult T-cell leukemia/lymphoma | Phosphorylation | 35210364 |
T | 83 | A | Gastric cancer | Phosphorylation | 32271880 |
- | - | D | Gastric cancer | Ubiquitination | 31393050 |
S | 127 | D | Renal cell carcinoma | Phosphorylation | 32926756 |
S | 127 | D | Lung cancer/carcinoma | Phosphorylation | 21060948 |
- | - | D | Colorectal cancer | Phosphorylation | 36468780 |
Y | 444 | D | Glioblastoma | Phosphorylation | 35723276 |
S | 127 | D | Prostate cancer | Phosphorylation | 36823643 |
Y | 407 | D | Glioblastoma | Phosphorylation | 35723276 |
Y | 391 | D | Glioblastoma | Phosphorylation | 35723276 |
S | 384 | D | Pancreatic cancer | Phosphorylation | 36828627 |
S | 387 | D | Pancreatic cancer | Phosphorylation | 36828627 |
S | 127 | D | Glioblastoma | Phosphorylation | 34343153 |
- | - | D | Oesophageal squamous cell carcinoma | Ubiquitination | 32896069 |
- | - | D | Pancreatic cancer | Ubiquitination | 36828627 |
S | 127 | D | Liver cancer | Phosphorylation | 28474680 |
S | 127 | D | Diabetes mellitus | Phosphorylation | 28474680 |
S | 127 | D | Coronary artery disease | Phosphorylation | 37104914 |
S | 127 | D | Bladder cancer | Phosphorylation | 26119935 |
- | - | D | Glioblastoma | Ubiquitination | 35723276 |
S | 127 | P | Hepatocellular cancer | Phosphorylation | 35597479 |
S | 127 | P | Colon cancer | Phosphorylation | 34206989 |
- | - | P | Myocardial ischaemic injury | Methylation | 35709329 |
S | 127 | P | Cervical cancer/carcinoma | Phosphorylation | 23027127 |
- | - | P | Gastric cancer | Phosphorylation | 23058008 |
T | 63 | U | Breast cancer | Phosphorylation | 37081542 |
- | - | U | Osteosarcoma | Ubiquitination | 31877302 |
T | 241 | U | Liver cancer | Phosphorylation | 28474680 |
S | 127 | U | Parkinson's disease | Phosphorylation | 32929029 |
- | - | U | Hepatocellular carcinoma | Ubiquitination | 32217697 |
- | - | U | Gastric cancer | Ubiquitination | 35318441 |
- | - | U | Thyroid cancer | Ubiquitination | 36813921 |
- | - | U | Osteosarcoma | Ubiquitination | 37184153 |
- | - | U | Esophageal squamous cell carcinoma | Ubiquitination | 36470870 |
- | - | U | Bladder cancer | Ubiquitination | 34315490 |
- | - | U | Cholangiocarcinoma | Ubiquitination | 35024322 |
- | - | U | Pancreatic cancer | Ubiquitination | 34353343 |
- | - | U | Gastric cancer | Ubiquitination | 37429790 |
S | 127 | U | Osteoarthritis | Phosphorylation | 37100374 |
S | 61 | U | Breast cancer | Phosphorylation | 37081542 |
- | - | U | Prostate cancer | Glycosylation | 38056280 |
S | 127 | U | Hepatocellular cancer | Phosphorylation | 35586495 |
T | 241 | U | Diabetes mellitus | Phosphorylation | 28474680 |
T | 143 | U | Esophageal squamous cell carcinoma | Phosphorylation | 35705994 |
Y | 357 | U | Gastric cancer | Phosphorylation | 31376289 |
S | 127 | U | Breast cancer | Phosphorylation | 36774339 |
S | 128 | U | Cancer | Phosphorylation | 31857346 |
S | 436 | U | Glioblastoma | Phosphorylation | 34343821 |
Y | 357 | U | Intrahepatic cholangiocarcinoma | Phosphorylation | 34052254 |
Y | 357 | U | Prostate cancer | Phosphorylation | 36084759 |
Y | 357 | U | Triple-negative breast cancer | Phosphorylation | 36633714 |
S | 227 | U | Pancreatic ductal adenocarcinoma | Phosphorylation | 34345207 |
Y | 394 | U | Squamous cell carcinoma | Phosphorylation | 27013234 |
Y | 357 | U | Squamous cell carcinoma | Phosphorylation | 27013234 |
Y | 341 | U | Squamous cell carcinoma | Phosphorylation | 27013234 |
Y | 188 | U | Breast cancer | Phosphorylation | 27428284 |
Y | 407 | U | Prostate cancer | Phosphorylation | 36979713 |
- | - | U | Hepatocellular carcinoma | Phosphorylation | 35041461 |
State Note: Based on the distinct PTM states in diseases, PTMD classified all disease-associated PTMs into six classes, including whether the up-regulation (U) or down-regulation (D) of PTM levels, the absence (A) or presence (P) of PTMs, and the creation (C) or disruption (N) of PTM sites are associated with diseases.
PTM-Drug Perturbation Response:
source: DecryptMNo data.
Function score:
source: funscoRNo data.