Id: | acc1535 |
Group: | 2sens |
Protein: | ERK2 |
Gene Symbol: | MAPK1 |
Protein Id: | P28482 |
Protein Name: | MK01_HUMAN |
PTM: | phosphorylation |
Site: | Tyr187 |
Site Sequence: | HDHTGFLTEYVATRWYRAPEI |
Disease Category: | Cancer |
Disease: | Breast Cancer |
Disease Subtype: | Ductal carcinoma |
Disease Cellline: | BT474 |
Disease Info: | |
Drug: | anti-HER2 phage-based vaccine |
Drug Info: | "The anti-HER2 phage-based vaccine is a therapeutic candidate utilizing M13 bacteriophages engineered to display HER2 antigens, designed to stimulate targeted immune responses against HER2-expressing cancers, with preclinical studies suggesting potential efficacy." |
Relation: |
anti-HER2 phage-based vaccine
➜
ERK2-Tyr187
DOWN
➜
Breast Cancer
Alleviate
|
Effect: | modulate |
Effect Info: | The phage-based HER2 vaccine can impair the occurrence and progression of breast cancer. The vaccine-induced anti-HER2 antibodies reduce the cell viability of BT-474 human breast cancer cells by inhibiting ERK phosphorylation and reactivating the function of retinoblastoma protein. |
Note: | Non-conventional drugs |
Score: | 3.0 |
Pubmed(PMID): | 36011047 |
Sentence Index: | 36011047_6-7 |
Sentence: | "The molecular mechanisms underlying the anticancer effect of vaccine-elicited anti-HER2 antibodies were analyzed in vitro against BT-474 human breast cancer cells, sensitive or resistant to trastuzumab. Immunoglobulins (IgG) purified from immune sera reduced cell viability mainly by impairing ERK phosphorylation and reactivating retinoblastoma protein function in both trastuzumab-sensitive and -resistant BT-474 cells." |
Sequence & Structure:
MAAAAAAGAGPEMVRGQVFDVGPRYTNLSYIGEGAYGMVCSAYDNVNKVRVAIKKISPFEHQTYCQRTLREIKILLRFRHENIIGINDIIRAPTIEQMKDVYIVQDLMETDLYKLLKTQHLSNDHICYFLYQILRGLKYIHSANVLHRDLKPSNLLLNTTCDLKICDFGLARVADPDHDHTGFLTEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEMLSNRPIFPGKHYLDQLNHILGILGSPSQEDLNCIINLKARNYLLSLPHKNKVPWNRLFPNADSKALDLLDKMLTFNPHKRIEVEQALAHPYLEQYYDPSDEPIAEAPFKFDMELDDLPKEKLKELIFEETARFQPGYRS
Select PDB:
Target | Drug name | MOA | Phase | Status | Disease | Source |
---|---|---|---|---|---|---|
MAPK1 | ULIXERTINIB | MAP kinase ERK2 inhibitor | 2 | Terminated | neoplasm | ClinicalTrials |
MAPK1 | TEMUTERKIB | Mitogen-activated protein kinase; ERK1/ERK2 inhibitor | 2 | Completed | pancreatic carcinoma | ClinicalTrials |
MAPK1 | ULIXERTINIB | MAP kinase ERK2 inhibitor | 2 | Recruiting | histiocytic neoplasm | ClinicalTrials |
MAPK1 | ULIXERTINIB | MAP kinase ERK2 inhibitor | 2 | Active, not recruiting | Uveal Melanoma | ClinicalTrials |
MAPK1 | TEMUTERKIB | Mitogen-activated protein kinase; ERK1/ERK2 inhibitor | 2 | Terminated | cancer | ClinicalTrials |
MAPK1 | ULIXERTINIB | MAP kinase ERK2 inhibitor | 1 | Completed | acute myeloid leukemia | ClinicalTrials |
MAPK1 | ULIXERTINIB | MAP kinase ERK2 inhibitor | 1 | Completed | myelodysplastic syndrome | ClinicalTrials |
MAPK1 | TEMUTERKIB | Mitogen-activated protein kinase; ERK1/ERK2 inhibitor | 1 | Recruiting | acute myeloid leukemia | ClinicalTrials |
MAPK1 | ULIXERTINIB | MAP kinase ERK2 inhibitor | 1 | Completed | neoplasm | ClinicalTrials ClinicalTrials |
MAPK1 | MK-8353 | MAP kinase ERK2 inhibitor | 1 | Completed | neoplasm | ClinicalTrials |
MAPK1 | RAVOXERTINIB | MAP kinase ERK2 inhibitor | 1 | Completed | neoplasm | ClinicalTrials |
MAPK1 | MK-8353 | MAP kinase ERK2 inhibitor | 1 | Terminated | neoplasm | ClinicalTrials |
MAPK1 | ULIXERTINIB | MAP kinase ERK2 inhibitor | 1 | Recruiting | pancreatic carcinoma | ClinicalTrials |
MAPK1 | ULIXERTINIB | MAP kinase ERK2 inhibitor | 1 | Terminated | pancreatic carcinoma | ClinicalTrials |
MAPK1 | ULIXERTINIB | MAP kinase ERK2 inhibitor | 1 | Recruiting | metastatic colorectal cancer | ClinicalTrials |
MAPK1 | KO-947 | Mitogen-activated protein kinase; ERK1/ERK2 inhibitor | 1 | Terminated | cancer | ClinicalTrials |
MAPK1 | MK-8353 | MAP kinase ERK2 inhibitor | 1 | Completed | colorectal cancer | ClinicalTrials |
MAPK1 | TEMUTERKIB | Mitogen-activated protein kinase; ERK1/ERK2 inhibitor | 0.5 | Recruiting | glioblastoma multiforme | ClinicalTrials |
MAPK1 | ULIXERTINIB | MAP kinase ERK2 inhibitor | 0.5 | Recruiting | Paraganglioma | ClinicalTrials |
Note: Only show clinically investigational or approved drugs with protein targets.
Protein Tractability:
source: Open TargetsPTM Intensity:
source: CPTACMAPK1-Tyr187 | |
---|---|
Cancer | Intensity |
BRCA | 0.772 |
COAD | 0.273 |
HGSC | 0.701 |
ccRCC | -0.806 |
GBM | 0.279 |
HNSC | 0.328 |
LUAD | 0.387 |
LUSC | 0.866 |
non_ccRCC | -2.593 |
PDAC | 0.32 |
UCEC | -0.527 |
PTM-Disease Association:
source: PTMDResidue | Position | State | Disease | Class | PMID |
---|---|---|---|---|---|
Y | 187 | U | Thyroid cancer/carcinoma | Phosphorylation | 17209045 |
Y | 187 | U | Triple-negative breast cancer | Phosphorylation | 28415597 |
State Note: Based on the distinct PTM states in diseases, PTMD classified all disease-associated PTMs into six classes, including whether the up-regulation (U) or down-regulation (D) of PTM levels, the absence (A) or presence (P) of PTMs, and the creation (C) or disruption (N) of PTM sites are associated with diseases.
PTM-Drug Perturbation Response:
source: DecryptMProtein | Gene | PTM | Position | Modified sequence | Cell | Drug | pEC50 | Regulation | Experiment |
---|---|---|---|---|---|---|---|---|---|
P28482 | MAPK1 | P | Tyr187 | VADPDHDHTGFLTEY(ph)VATR | A431 | Imatinib | 5.4775 | up | |
P28482 | MAPK1 | P | Tyr187 | VADPDHDHTGFLTEY(ph)VATR | BT-474 | Lapatinib | 6.6172 | down | |
P28482 | MAPK1 | P | Tyr187 | VADPDHDHTGFLTEY(ph)VATR | K562 | Dasatinib | 8.8776 | down | |
P28482 | MAPK1 | P | Tyr187 | VADPDHDHTGFLTEY(ph)VATR | KYSE-520 | SHP099 | 6.2002 | down | |
P28482 | MAPK1 | P | Tyr187 | VADPDHDHTGFLTEY(ph)VATR | MDA-MB-175 | Lapatinib | 7.3646 | down | |
P28482 | MAPK1 | P | Tyr187 | VADPDHDHTGFLTEY(ph)VATR | MDA-MB-175 | Pertuzumab | -4.632 | down | |
P28482 | MAPK1 | P | Tyr187 | VADPDHDHTGFLTEY(ph)VATR | PC-9 | LapatinibAZD4547 | 6.4194 | down | |
P28482 | MAPK1 | P | Tyr187 | VADPDHDHTGFLTEY(ph)VATR | PC-9 | Lapatinib | 6.4558 | down | |
P28482 | MAPK1 | P | Thr185;Tyr187 | VADPDHDHTGFLT(ph)EY(ph)VATR | SK-BR-3 | Trastuzumab | -1.2287 | - | |
P28482 | MAPK1 | P | Tyr187 | VADPDHDHTGFLTEY(ph)VATR | A431 | Dasatinib | 6.1777 | - | |
P28482 | MAPK1 | P | Tyr187 | VADPDHDHTGFLTEY(ph)VATR | SK-BR-3 | Trastuzumab | -0.81 | - | |
P28482 | MAPK1 | P | Tyr187 | VADPDHDHTGFLTEY(ph)VATR | SK-BR-3 | Pertuzumab | -1.7704 | - | |
P28482 | MAPK1 | P | Tyr187 | VADPDHDHTGFLTEY(ph)VATR | SK-BR-3 | Lapatinib | 4.7218 | - | |
P28482 | MAPK1 | P | Tyr187;Thr190 | VADPDHDHTGFLTEY(ph)VAT(ph)R | PC-9 | AZD4547 | 1.938 | - | |
P28482 | MAPK1 | P | Tyr187 | VADPDHDHTGFLTEY(ph)VATR | PC-9 | AZD4547 | 7.196 | - | |
P28482 | MAPK1 | P | Thr185;Tyr187 | VADPDHDHTGFLT(ph)EY(ph)VATR | PC-9 | AZD4547 | 7.2923 | - | |
P28482 | MAPK1 | P | Thr185;Tyr187 | VADPDHDHTGFLT(ph)EY(ph)VATR | MDA-MB-175 | Trastuzumab | -1.6811 | - | |
P28482 | MAPK1 | P | Tyr187 | VADPDHDHTGFLTEY(ph)VATR | MDA-MB-175 | Trastuzumab | 5 | - | |
P28482 | MAPK1 | P | Tyr187 | VADPDHDHTGFLTEY(ph)VATR | K562 | Imatinib | 7.13 | - | |
P28482 | MAPK1 | P | Tyr187 | VADPDHDHTGFLTEY(ph)VATR | BT-474 | Trastuzumab | -2.1745 | - | |
P28482 | MAPK1 | P | Tyr187 | VADPDHDHTGFLTEY(ph)VATR | BT-474 | Pertuzumab | -1.9633 | - |
pEC50 Note: pEC50 is the negative logarithm of EC50 (half-maximal effective concentration, dosage unit Mol), calculated as pEC50 = -log10(EC50), which quantifies the potency of a drug or compound.
Function score:
source: funscoRNo data.