Id: acc1398
Group: 2sens
Protein: FoxO1
Gene Symbol: FOXO1
Protein Id: Q12778
Protein Name: FOXO1_HUMAN
PTM: phosphorylation
Site: Ser218
Site Sequence: WKNSIRHNLSLHSKFIRVQNE
Disease Category: Cancer
Disease: Sarcoma
Disease Subtype: angiosarcoma
Disease Cellline: AS-M
Disease Info:
Drug: ATG(aPKC inhibitor)
Drug Info: -
Relation:
ATG(aPKC inhibitor)
FoxO1-Ser218 DOWN
Sarcoma Alleviate
Effect: modulate
Effect Info: The drug inhibits the phosphorylation of FoxO1 and reduces proliferation.
Note:
Score: 4.0
Pubmed(PMID): 30559384
Sentence Index:
Sentence:

Sequence & Structure:

MAEAPQVVEIDPDFEPLPRPRSCTWPLPRPEFSQSNSATSSPAPSGSAAANPDAAAGLPSASAAAVSADFMSNLSLLEESEDFPQAPGSVAAAVAAAAAAAATGGLCGDFQGPEAGCLHPAPPQPPPPGPLSQHPPVPPAAAGPLAGQPRKSSSSRRNAWGNLSYADLITKAIESSAEKRLTLSQIYEWMVKSVPYFKDKGDSNSSAGWKNSIRHNLSLHSKFIRVQNEGTGKSSWWMLNPEGGKSGKSPRRRAASMDNNSKFAKSRSRAAKKKASLQSGQEGAGDSPGSQFSKWPASPGSHSNDDFDNWSTFRPRTSSNASTISGRLSPIMTEQDDLGEGDVHSMVYPPSAAKMASTLPSLSEISNPENMENLLDNLNLLSSPTSLTVSTQSSPGTMMQQTPCYSFAPPNTSLNSPSPNYQKYTYGQSSMSPLPQMPIQTLQDNKSSYGGMSQYNCAPGLLKELLTSDSPPHNDIMTPVDPGVAQPNSRVLGQNVMMGPNSVMSTYGSQASHNKMMNPSSHTHPGHAQQTSAVNGRPLPHTVSTMPHTSGMNRLTQVKTPVQVPLPHPMQMSALGGYSSVSSCNGYGRMGLLHQEKLPSDLDGMFIERLDCDMESIIRNDLMDGDTLDFNFDNVLPNQSFPHSVKTTTHSWVSG

Select PDB:

Known Drugs:

source: Multi-Sources

(see table)

No data.

Protein Tractability:

source: Open Targets
Small molecule
Antibody
PROTAC
Other modalities
Approved Drug
Advanced Clinical
Phase 1 Clinical
Structure with Ligand
High-Quality Ligand
High-Quality Pocket
Med-Quality Pocket
Druggable Family
Approved Drug
Advanced Clinical
Phase 1 Clinical
UniProt loc high conf
GO CC high conf
UniProt loc med conf
UniProt SigP or TMHMM
GO CC med conf
Human Protein Atlas loc
Approved Drug
Advanced Clinical
Phase 1 Clinical
Literature
UniProt Ubiquitination
Database Ubiquitination
Half-life Data
Small Molecule Binder
Approved Drug
Advanced Clinical
Phase 1 Clinical

PTM Intensity:

source: CPTAC
FOXO1-Ser218
Cancer Intensity
BRCA 1.611
COAD
HGSC
ccRCC
GBM -0.033
HNSC
LUAD
LUSC -0.786
non_ccRCC
PDAC -0.882
UCEC 0.089

PTM-Disease Association:

source: PTMD
Residue Position State Disease Class PMID
S 256 D Hepatitis Phosphorylation 18316359
T 24 D Head and neck squamous cell carcinoma Phosphorylation 21281788
S 249 P Prostate cancer/carcinoma/adenocarcinoma Phosphorylation 21969818
K 273 U Colon cancer Methylation 30535125
S 256 U Astrocytoma/astrocytoma glioblastoma Phosphorylation 23874926
S 256 U Breast cancer Phosphorylation 36797347
S 319 U Sjogren's syndrome Phosphorylation 34948236
T 24 U Breast cancer Phosphorylation 36797347
T 24 U Prostate cancer Phosphorylation 36720852
S 329 U B-cell acute lymphoblastic leukemia Phosphorylation 33393494
S 319 U Melanoma Phosphorylation 36210843
S 319 U Prostate cancer Phosphorylation 36720852
- - U Glioma Ubiquitination 33408486
- - U Hepatocellular carcinoma Ubiquitination 37099251

State Note: Based on the distinct PTM states in diseases, PTMD classified all disease-associated PTMs into six classes, including whether the up-regulation (U) or down-regulation (D) of PTM levels, the absence (A) or presence (P) of PTMs, and the creation (C) or disruption (N) of PTM sites are associated with diseases.

PTM-Drug Perturbation Response:

source: DecryptM

No data.

Function score:

source: funscoR

No data.

Cross Links: