Id: | acc1397 |
Group: | 2sens |
Protein: | FoxO1 |
Gene Symbol: | FOXO1 |
Protein Id: | Q12778 |
Protein Name: | FOXO1_HUMAN |
PTM: | phosphorylation |
Site: | Ser218 |
Site Sequence: | WKNSIRHNLSLHSKFIRVQNE |
Disease Category: | Cancer |
Disease: | Sarcoma |
Disease Subtype: | angiosarcoma |
Disease Cellline: | ISO-HAS-B |
Disease Info: | |
Drug: | ATM(aPKC inhibitor) |
Drug Info: | - |
Relation: |
ATM(aPKC inhibitor)
➜
FoxO1-Ser218
DOWN
➜
Sarcoma
Alleviate
|
Effect: | modulate |
Effect Info: | The drug inhibits the phosphorylation of FoxO1 and reduces proliferation. |
Note: | |
Score: | 4.0 |
Pubmed(PMID): | 30559384 |
Sentence Index: | 30559384_6-7 |
Sentence: | "We find this pathway is strongly activated in the malignant vascular sarcoma, angiosarcoma, and aPKC inhibition reduces c-Myc expression and proliferation of angiosarcoma cells. Moreover, FoxO1 phosphorylation at Ser218 and aPKC expression correlates with poor patient prognosis." |
Sequence & Structure:
MAEAPQVVEIDPDFEPLPRPRSCTWPLPRPEFSQSNSATSSPAPSGSAAANPDAAAGLPSASAAAVSADFMSNLSLLEESEDFPQAPGSVAAAVAAAAAAAATGGLCGDFQGPEAGCLHPAPPQPPPPGPLSQHPPVPPAAAGPLAGQPRKSSSSRRNAWGNLSYADLITKAIESSAEKRLTLSQIYEWMVKSVPYFKDKGDSNSSAGWKNSIRHNLSLHSKFIRVQNEGTGKSSWWMLNPEGGKSGKSPRRRAASMDNNSKFAKSRSRAAKKKASLQSGQEGAGDSPGSQFSKWPASPGSHSNDDFDNWSTFRPRTSSNASTISGRLSPIMTEQDDLGEGDVHSMVYPPSAAKMASTLPSLSEISNPENMENLLDNLNLLSSPTSLTVSTQSSPGTMMQQTPCYSFAPPNTSLNSPSPNYQKYTYGQSSMSPLPQMPIQTLQDNKSSYGGMSQYNCAPGLLKELLTSDSPPHNDIMTPVDPGVAQPNSRVLGQNVMMGPNSVMSTYGSQASHNKMMNPSSHTHPGHAQQTSAVNGRPLPHTVSTMPHTSGMNRLTQVKTPVQVPLPHPMQMSALGGYSSVSSCNGYGRMGLLHQEKLPSDLDGMFIERLDCDMESIIRNDLMDGDTLDFNFDNVLPNQSFPHSVKTTTHSWVSG
Select PDB:
No data.
Protein Tractability:
source: Open TargetsPTM Intensity:
source: CPTACFOXO1-Ser218 | |
---|---|
Cancer | Intensity |
BRCA | 1.611 |
COAD | |
HGSC | |
ccRCC | |
GBM | -0.033 |
HNSC | |
LUAD | |
LUSC | -0.786 |
non_ccRCC | |
PDAC | -0.882 |
UCEC | 0.089 |
PTM-Disease Association:
source: PTMDResidue | Position | State | Disease | Class | PMID |
---|---|---|---|---|---|
S | 256 | D | Hepatitis | Phosphorylation | 18316359 |
T | 24 | D | Head and neck squamous cell carcinoma | Phosphorylation | 21281788 |
S | 249 | P | Prostate cancer/carcinoma/adenocarcinoma | Phosphorylation | 21969818 |
K | 273 | U | Colon cancer | Methylation | 30535125 |
S | 256 | U | Astrocytoma/astrocytoma glioblastoma | Phosphorylation | 23874926 |
S | 256 | U | Breast cancer | Phosphorylation | 36797347 |
S | 319 | U | Sjogren's syndrome | Phosphorylation | 34948236 |
T | 24 | U | Breast cancer | Phosphorylation | 36797347 |
T | 24 | U | Prostate cancer | Phosphorylation | 36720852 |
S | 329 | U | B-cell acute lymphoblastic leukemia | Phosphorylation | 33393494 |
S | 319 | U | Melanoma | Phosphorylation | 36210843 |
S | 319 | U | Prostate cancer | Phosphorylation | 36720852 |
- | - | U | Glioma | Ubiquitination | 33408486 |
- | - | U | Hepatocellular carcinoma | Ubiquitination | 37099251 |
State Note: Based on the distinct PTM states in diseases, PTMD classified all disease-associated PTMs into six classes, including whether the up-regulation (U) or down-regulation (D) of PTM levels, the absence (A) or presence (P) of PTMs, and the creation (C) or disruption (N) of PTM sites are associated with diseases.
PTM-Drug Perturbation Response:
source: DecryptMNo data.
Function score:
source: funscoRNo data.