Id: | acc1348 |
Group: | 2sens |
Protein: | FOXO3A |
Gene Symbol: | FOXO3 |
Protein Id: | O43524 |
Protein Name: | FOXO3_HUMAN |
PTM: | phosphorylation |
Site: | Thr32 |
Site Sequence: | EPQSRPRSCTWPLQRPELQAS |
Disease Category: | Cancer |
Disease: | Breast Cancer |
Disease Subtype: | |
Disease Cellline: | MDA-MB-231 |
Disease Info: | |
Drug: | IBP OE |
Drug Info: | - |
Relation: |
IBP OE
➜
FOXO3A-Thr32
UP
➜
Breast Cancer
Aggravate
|
Effect: | modulate |
Effect Info: | "Overexpression of IBP promotes the phosphorylation of mTOR, Akt, and FOXO3a, thereby promoting the growth of breast cancer cells." |
Note: | Non-conventional drugs |
Score: | 3.0 |
Pubmed(PMID): | 24113176 |
Sentence Index: | 24113176_4-5 |
Sentence: | "In this study, we for the first time, reported that upregulation of IBP expression significantly suppressed the autophagy of breast cancer cells, and downregulation of IBP expression markedly induced autophagy of these cells. Further investigation revealed that IBP effectively counteracted autophagy by directly activating mammalian target of rapamycin complex 2 (mTORC2) and upregulating phosphorylation of Akt on ser473 and FOXO3a on Thr32." |
Sequence & Structure:
MAEAPASPAPLSPLEVELDPEFEPQSRPRSCTWPLQRPELQASPAKPSGETAADSMIPEEEDDEDDEDGGGRAGSAMAIGGGGGSGTLGSGLLLEDSARVLAPGGQDPGSGPATAAGGLSGGTQALLQPQQPLPPPQPGAAGGSGQPRKCSSRRNAWGNLSYADLITRAIESSPDKRLTLSQIYEWMVRCVPYFKDKGDSNSSAGWKNSIRHNLSLHSRFMRVQNEGTGKSSWWIINPDGGKSGKAPRRRAVSMDNSNKYTKSRGRAAKKKAALQTAPESADDSPSQLSKWPGSPTSRSSDELDAWTDFRSRTNSNASTVSGRLSPIMASTELDEVQDDDAPLSPMLYSSSASLSPSVSKPCTVELPRLTDMAGTMNLNDGLTENLMDDLLDNITLPPSQPSPTGGLMQRSSSFPYTTKGSGLGSPTSSFNSTVFGPSSLNSLRQSPMQTIQENKPATFSSMSHYGNQTLQDLLTSDSLSHSDVMMTQSDPLMSQASTAVSAQNSRRNVMLRNDPMMSFAAQPNQGSLVNQNLLHHQHQTQGALGGSRALSNSVSNMGLSESSSLGSAKHQQQSPVSQSMQTLSDSLSGSSLYSTSANLPVMGHEKFPSDLDLDMFNGSLECDMESIIRSELMDADGLDFNFDSLISTQNVVGLNVGNFTGAKQASSQSWVPG
Select PDB:
No data.
Protein Tractability:
source: Open TargetsPTM Intensity:
source: CPTACFOXO3-Thr32 | |
---|---|
Cancer | Intensity |
BRCA | |
COAD | |
HGSC | |
ccRCC | |
GBM | |
HNSC | |
LUAD | |
LUSC | |
non_ccRCC | |
PDAC | |
UCEC |
PTM-Disease Association:
source: PTMDResidue | Position | State | Disease | Class | PMID |
---|---|---|---|---|---|
T | 32 | U | Breast cancer | Phosphorylation | 36797347 |
T | 32 | U | Non-small cell lung cancer | Phosphorylation | 35459265 |
State Note: Based on the distinct PTM states in diseases, PTMD classified all disease-associated PTMs into six classes, including whether the up-regulation (U) or down-regulation (D) of PTM levels, the absence (A) or presence (P) of PTMs, and the creation (C) or disruption (N) of PTM sites are associated with diseases.
PTM-Drug Perturbation Response:
source: DecryptMProtein | Gene | PTM | Position | Modified sequence | Cell | Drug | pEC50 | Regulation | Experiment |
---|---|---|---|---|---|---|---|---|---|
O43524 | FOXO3 | P | Thr32 | SCT(ph)WPLQRPELQASPAK | A431 | Dasatinib | 5.9597 | down | |
O43524 | FOXO3 | P | Thr32 | SCT(ph)WPLQRPELQASPAK | A431 | Gefitinib | 5.4679 | down | |
O43524 | FOXO3 | P | Thr32 | SCT(ph)WPLQRPELQASPAK | A431 | Gefitinib | 4.9989 | down | |
O43524 | FOXO3 | P | Thr32 | SCT(ph)WPLQRPELQASPAKPSGETAADSMIPEEEDDEDDEDGGGR | A431 | Dasatinib | 6.2182 | - | |
O43524 | FOXO3 | P | Thr32;Ser43 | SCT(ph)WPLQRPELQAS(ph)PAKPSGETAADSMIPEEEDDEDDEDGGGR | A431 | Dasatinib | 4.3461 | - | |
O43524 | FOXO3 | P | Thr32 | SCT(ph)WPLQRPELQASPAKPSGETAADSMIPEEEDDEDDEDGGGR | A431 | Dasatinib | 4.4676 | - | |
O43524 | FOXO3 | P | Thr32 | SCT(ph)WPLQRPELQASPAK | A431 | Dasatinib | 7.2352 | - | |
O43524 | FOXO3 | P | Thr32 | SCT(ph)WPLQRPELQASPAKPSGETAADSMIPEEEDDEDDEDGGGR | A431 | Dasatinib | 7.1471 | - | |
O43524 | FOXO3 | P | Thr32;Ser43 | SCT(ph)WPLQRPELQAS(ph)PAKPSGETAADSMIPEEEDDEDDEDGGGR | A431 | Dasatinib | 8.5156 | - | |
O43524 | FOXO3 | P | Thr32 | SCT(ph)WPLQRPELQASPAKPSGETAADSMIPEEEDDEDDEDGGGR | A431 | Dasatinib | 5.8468 | - | |
O43524 | FOXO3 | P | Thr32 | SCT(ph)WPLQRPELQASPAKPSGETAADSMIPEEEDDEDDEDGGGR | A431 | Gefitinib | 6.093 | - | |
O43524 | FOXO3 | P | Thr32 | SCT(ph)WPLQRPELQASPAK | A431 | Gefitinib | 6.3386 | - | |
O43524 | FOXO3 | P | Thr32 | SCT(ph)WPLQRPELQASPAKPSGETAADSMIPEEEDDEDDEDGGGR | A431 | Gefitinib | 5.744 | - |
pEC50 Note: pEC50 is the negative logarithm of EC50 (half-maximal effective concentration, dosage unit Mol), calculated as pEC50 = -log10(EC50), which quantifies the potency of a drug or compound.
Function score:
source: funscoRNo data.