Id: | acc1213 |
Group: | 2sens |
Protein: | BCL2 |
Gene Symbol: | BCL2 |
Protein Id: | P10415 |
Protein Name: | BCL2_HUMAN |
PTM: | phosphorylation |
Site: | Ser70 |
Site Sequence: | ASRDPVARTSPLQTPAAPGAA |
Disease Category: | Cancer |
Disease: | Ovarian Cancer |
Disease Subtype: | |
Disease Cellline: | A2780 |
Disease Info: | |
Drug: | Paclitaxel + ABT-199 |
Drug Info: | "Paclitaxel is a chemotherapeutic agent that stabilizes microtubules to inhibit cell division, widely used in the treatment of ovarian, breast, and lung cancers. ABT-199 (Venetoclax) is a selective BCL-2 inhibitor that induces apoptosis in cancer cells by restoring mitochondrial apoptotic pathways, primarily utilized in certain hematologic malignancies." |
Relation: |
Paclitaxel + ABT-199
➜
BCL2-Ser70
UP
➜
Ovarian Cancer
Aggravate
|
Effect: | modulate |
Effect Info: | Paclitaxel-induced pBcl-2 impairs the synergistic effect of paclitaxel and ABT-199 by protecting the Bcl-2/Bim and Bcl-2/Bax complexes from disruption. |
Note: | drug comb |
Score: | 4.0 |
Pubmed(PMID): | 29953843 |
Sentence Index: | 29953843_7-8 |
Sentence: | "However, paclitaxel-induced Bcl-2 phosphorylation impaired the synergistic effect by impeding the freeing of Bax and Bim by ABT-199 because ABT-199 cannot hit phosphorylated Bcl-2 (pBcl-2). By means of a correlation analysis of JNK level with CI value in combination with overexpressing or silencing JNK protein in cancer cells, we identified basal JNK1 level as a potential biomarker for predicting the level of pBcl-2 upon paclitaxel treatment, and thus for predicting a synergistic response." |
Sequence & Structure:
MAHAGRTGYDNREIVMKYIHYKLSQRGYEWDAGDVGAAPPGAAPAPGIFSSQPGHTPHPAASRDPVARTSPLQTPAAPGAAAGPALSPVPPVVHLTLRQAGDDFSRRYRRDFAEMSSQLHLTPFTARGRFATVVEELFRDGVNWGRIVAFFEFGGVMCVESVNREMSPLVDNIALWMTEYLNRHLHTWIQDNGGWDAFVELYGPSMRPLFDFSWLSLKTLLSLALVGACITLGAYLGHK
Select PDB:
Target | Drug name | MOA | Phase | Status | Disease | Source |
---|---|---|---|---|---|---|
BCL2 | VENETOCLAX | Apoptosis regulator Bcl-2 inhibitor | 4 | - | chronic lymphocytic leukemia | EMA DailyMed FDA |
BCL2 | VENETOCLAX | Apoptosis regulator Bcl-2 inhibitor | 4 | Not yet recruiting | chronic lymphocytic leukemia | ClinicalTrials |
BCL2 | VENETOCLAX | Apoptosis regulator Bcl-2 inhibitor | 4 | - | neoplasm | ATC |
BCL2 | VENETOCLAX | Apoptosis regulator Bcl-2 inhibitor | 3 | Completed | chronic lymphocytic leukemia | ClinicalTrials ClinicalTrials ClinicalTrials ClinicalTrials ClinicalTrials |
BCL2 | VENETOCLAX | Apoptosis regulator Bcl-2 inhibitor | 3 | Not yet recruiting | chronic lymphocytic leukemia | ClinicalTrials |
BCL2 | VENETOCLAX | Apoptosis regulator Bcl-2 inhibitor | 3 | Recruiting | chronic lymphocytic leukemia | ClinicalTrials ClinicalTrials ClinicalTrials ClinicalTrials ClinicalTrials |
BCL2 | VENETOCLAX | Apoptosis regulator Bcl-2 inhibitor | 3 | Active, not recruiting | chronic lymphocytic leukemia | ClinicalTrials ClinicalTrials ClinicalTrials ClinicalTrials ClinicalTrials ClinicalTrials ClinicalTrials ClinicalTrials ClinicalTrials |
BCL2 | VENETOCLAX | Apoptosis regulator Bcl-2 inhibitor | 3 | Active, not recruiting | acute myeloid leukemia | ClinicalTrials ClinicalTrials ClinicalTrials |
BCL2 | VENETOCLAX | Apoptosis regulator Bcl-2 inhibitor | 3 | Completed | acute myeloid leukemia | ClinicalTrials ClinicalTrials |
BCL2 | VENETOCLAX | Apoptosis regulator Bcl-2 inhibitor | 3 | Not yet recruiting | acute myeloid leukemia | ClinicalTrials |
BCL2 | VENETOCLAX | Apoptosis regulator Bcl-2 inhibitor | 3 | Active, not recruiting | myelodysplastic syndrome | ClinicalTrials |
BCL2 | VENETOCLAX | Apoptosis regulator Bcl-2 inhibitor | 3 | Recruiting | acute myeloid leukemia | ClinicalTrials ClinicalTrials ClinicalTrials ClinicalTrials |
BCL2 | VENETOCLAX | Apoptosis regulator Bcl-2 inhibitor | 3 | Terminated | acute myeloid leukemia | ClinicalTrials ClinicalTrials |
BCL2 | VENETOCLAX | Apoptosis regulator Bcl-2 inhibitor | 3 | Active, not recruiting | childhood acute myeloid leukemia | ClinicalTrials |
BCL2 | OBLIMERSEN SODIUM | Bcl-2 mRNA antisense inhibitor | 3 | Completed | cutaneous melanoma | ClinicalTrials |
BCL2 | OBLIMERSEN SODIUM | Bcl-2 mRNA antisense inhibitor | 3 | Completed | leukemia | ClinicalTrials |
BCL2 | OBATOCLAX | Apoptosis regulator Bcl-2 inhibitor | 3 | Withdrawn | small cell lung carcinoma | ClinicalTrials |
BCL2 | OBATOCLAX MESYLATE | Apoptosis regulator Bcl-2 inhibitor | 3 | Withdrawn | small cell lung carcinoma | ClinicalTrials |
BCL2 | OBLIMERSEN SODIUM | Bcl-2 mRNA antisense inhibitor | 3 | Completed | multiple myeloma | ClinicalTrials |
BCL2 | VENETOCLAX | Apoptosis regulator Bcl-2 inhibitor | 3 | Active, not recruiting | multiple myeloma | ClinicalTrials |
BCL2 | VENETOCLAX | Apoptosis regulator Bcl-2 inhibitor | 3 | Completed | multiple myeloma | ClinicalTrials |
BCL2 | NAVITOCLAX | Apoptosis regulator Bcl-2 inhibitor | 3 | Active, not recruiting | primary myelofibrosis | ClinicalTrials ClinicalTrials |
BCL2 | OBLIMERSEN SODIUM | Bcl-2 mRNA antisense inhibitor | 3 | Withdrawn | lymphoid leukemia | ClinicalTrials |
BCL2 | VENETOCLAX | Apoptosis regulator Bcl-2 inhibitor | 3 | Completed | Mantle cell lymphoma | ClinicalTrials |
BCL2 | VENETOCLAX | Apoptosis regulator Bcl-2 inhibitor | 3 | Recruiting | cancer | ClinicalTrials |
Note: Only show clinically investigational or approved drugs with protein targets.
Protein Tractability:
source: Open TargetsPTM Intensity:
source: CPTACNo intensity data of this site,
show all other sites!
BCL2L11-Ser104 | |||||
---|---|---|---|---|---|
Cancer | Intensity | ||||
BRCA | |||||
COAD | |||||
HGSC | 0.707 | ||||
ccRCC | |||||
GBM | |||||
HNSC | |||||
LUAD | |||||
LUSC | |||||
non_ccRCC | |||||
PDAC | |||||
UCEC | -0.707 |
BCL2L11-Ser118 | |||||
---|---|---|---|---|---|
Cancer | Intensity | ||||
BRCA | |||||
COAD | |||||
HGSC | 0.707 | ||||
ccRCC | |||||
GBM | |||||
HNSC | -0.707 | ||||
LUAD | |||||
LUSC | |||||
non_ccRCC | |||||
PDAC | |||||
UCEC |
BCL2L11-Ser77 | |||||
---|---|---|---|---|---|
Cancer | Intensity | ||||
BRCA | -1.869 | ||||
COAD | |||||
HGSC | 1.655 | ||||
ccRCC | 0.169 | ||||
GBM | |||||
HNSC | 0.422 | ||||
LUAD | 0.134 | ||||
LUSC | -0.138 | ||||
non_ccRCC | 0.29 | ||||
PDAC | |||||
UCEC | -0.663 |
BCL2L11-Ser92 | |||||
---|---|---|---|---|---|
Cancer | Intensity | ||||
BRCA | |||||
COAD | |||||
HGSC | |||||
ccRCC | |||||
GBM | |||||
HNSC | -0.707 | ||||
LUAD | 0.707 | ||||
LUSC | |||||
non_ccRCC | |||||
PDAC | |||||
UCEC |
BCL2L11-Ser93 | |||||
---|---|---|---|---|---|
Cancer | Intensity | ||||
BRCA | |||||
COAD | |||||
HGSC | |||||
ccRCC | |||||
GBM | |||||
HNSC | -0.707 | ||||
LUAD | 0.707 | ||||
LUSC | |||||
non_ccRCC | |||||
PDAC | |||||
UCEC |
BCL2L11-Ser94 | |||||
---|---|---|---|---|---|
Cancer | Intensity | ||||
BRCA | -1.664 | ||||
COAD | |||||
HGSC | 1.002 | ||||
ccRCC | -0.246 | ||||
GBM | |||||
HNSC | -0.477 | ||||
LUAD | 0.629 | ||||
LUSC | -0.105 | ||||
non_ccRCC | 1.47 | ||||
PDAC | |||||
UCEC | -0.61 |
BCL2L12-Ser113 | |||||
---|---|---|---|---|---|
Cancer | Intensity | ||||
BRCA | -0.987 | ||||
COAD | |||||
HGSC | |||||
ccRCC | -0.026 | ||||
GBM | |||||
HNSC | |||||
LUAD | |||||
LUSC | |||||
non_ccRCC | |||||
PDAC | |||||
UCEC | 1.013 |
BCL2L12-Ser121 | |||||
---|---|---|---|---|---|
Cancer | Intensity | ||||
BRCA | -1.134 | ||||
COAD | |||||
HGSC | 1.006 | ||||
ccRCC | 0.652 | ||||
GBM | |||||
HNSC | |||||
LUAD | |||||
LUSC | |||||
non_ccRCC | |||||
PDAC | |||||
UCEC | -0.524 |
BCL2L12-Ser194 | |||||
---|---|---|---|---|---|
Cancer | Intensity | ||||
BRCA | |||||
COAD | |||||
HGSC | |||||
ccRCC | |||||
GBM | |||||
HNSC | 0.153 | ||||
LUAD | 0.915 | ||||
LUSC | -1.068 | ||||
non_ccRCC | |||||
PDAC | |||||
UCEC |
BCL2L12-Ser195 | |||||
---|---|---|---|---|---|
Cancer | Intensity | ||||
BRCA | 0.374 | ||||
COAD | |||||
HGSC | |||||
ccRCC | -1.133 | ||||
GBM | |||||
HNSC | |||||
LUAD | |||||
LUSC | |||||
non_ccRCC | |||||
PDAC | |||||
UCEC | 0.759 |
BCL2L12-Ser241 | |||||
---|---|---|---|---|---|
Cancer | Intensity | ||||
BRCA | |||||
COAD | -0.993 | ||||
HGSC | |||||
ccRCC | |||||
GBM | 1.084 | ||||
HNSC | -0.554 | ||||
LUAD | 1.075 | ||||
LUSC | -0.613 | ||||
non_ccRCC | |||||
PDAC | |||||
UCEC |
BCL2L12-Ser242 | |||||
---|---|---|---|---|---|
Cancer | Intensity | ||||
BRCA | |||||
COAD | -0.42 | ||||
HGSC | -1.185 | ||||
ccRCC | -0.19 | ||||
GBM | |||||
HNSC | 0.276 | ||||
LUAD | |||||
LUSC | |||||
non_ccRCC | |||||
PDAC | |||||
UCEC | 1.519 |
BCL2L12-Ser272 | |||||
---|---|---|---|---|---|
Cancer | Intensity | ||||
BRCA | |||||
COAD | -0.088 | ||||
HGSC | |||||
ccRCC | |||||
GBM | |||||
HNSC | 0.237 | ||||
LUAD | -1.365 | ||||
LUSC | -0.208 | ||||
non_ccRCC | |||||
PDAC | 1.424 | ||||
UCEC |
BCL2L12-Ser273 | |||||
---|---|---|---|---|---|
Cancer | Intensity | ||||
BRCA | 0.524 | ||||
COAD | |||||
HGSC | 0.391 | ||||
ccRCC | -1.495 | ||||
GBM | |||||
HNSC | |||||
LUAD | |||||
LUSC | |||||
non_ccRCC | |||||
PDAC | |||||
UCEC | 0.58 |
BCL2L12-Thr117 | |||||
---|---|---|---|---|---|
Cancer | Intensity | ||||
BRCA | 0.35 | ||||
COAD | |||||
HGSC | -1.485 | ||||
ccRCC | 0.687 | ||||
GBM | |||||
HNSC | |||||
LUAD | |||||
LUSC | |||||
non_ccRCC | |||||
PDAC | |||||
UCEC | 0.449 |
BCL2L13-Ser288 | |||||
---|---|---|---|---|---|
Cancer | Intensity | ||||
BRCA | |||||
COAD | |||||
HGSC | |||||
ccRCC | |||||
GBM | 0.707 | ||||
HNSC | |||||
LUAD | -0.707 | ||||
LUSC | |||||
non_ccRCC | |||||
PDAC | |||||
UCEC |
BCL2L13-Ser291 | |||||
---|---|---|---|---|---|
Cancer | Intensity | ||||
BRCA | |||||
COAD | |||||
HGSC | |||||
ccRCC | |||||
GBM | 0.707 | ||||
HNSC | |||||
LUAD | -0.707 | ||||
LUSC | |||||
non_ccRCC | |||||
PDAC | |||||
UCEC |
BCL2L13-Ser312 | |||||
---|---|---|---|---|---|
Cancer | Intensity | ||||
BRCA | -1.693 | ||||
COAD | |||||
HGSC | |||||
ccRCC | 0.081 | ||||
GBM | |||||
HNSC | -0.729 | ||||
LUAD | |||||
LUSC | -0.194 | ||||
non_ccRCC | 1.241 | ||||
PDAC | 0.345 | ||||
UCEC | 0.948 |
BCL2L13-Ser315 | |||||
---|---|---|---|---|---|
Cancer | Intensity | ||||
BRCA | -1.352 | ||||
COAD | |||||
HGSC | 1.857 | ||||
ccRCC | -0.415 | ||||
GBM | |||||
HNSC | -0.336 | ||||
LUAD | |||||
LUSC | -0.57 | ||||
non_ccRCC | 1.042 | ||||
PDAC | -0.121 | ||||
UCEC | -0.106 |
BCL2L13-Ser327 | |||||
---|---|---|---|---|---|
Cancer | Intensity | ||||
BRCA | |||||
COAD | |||||
HGSC | 0.707 | ||||
ccRCC | |||||
GBM | |||||
HNSC | -0.707 | ||||
LUAD | |||||
LUSC | |||||
non_ccRCC | |||||
PDAC | |||||
UCEC |
BCL2L13-Ser329 | |||||
---|---|---|---|---|---|
Cancer | Intensity | ||||
BRCA | |||||
COAD | |||||
HGSC | 0.787 | ||||
ccRCC | -0.543 | ||||
GBM | |||||
HNSC | -1.095 | ||||
LUAD | |||||
LUSC | -0.447 | ||||
non_ccRCC | |||||
PDAC | |||||
UCEC | 1.298 |
BCL2L13-Ser395 | |||||
---|---|---|---|---|---|
Cancer | Intensity | ||||
BRCA | |||||
COAD | 0.707 | ||||
HGSC | -0.707 | ||||
ccRCC | |||||
GBM | |||||
HNSC | |||||
LUAD | |||||
LUSC | |||||
non_ccRCC | |||||
PDAC | |||||
UCEC |
BCL2L13-Ser420 | |||||
---|---|---|---|---|---|
Cancer | Intensity | ||||
BRCA | |||||
COAD | |||||
HGSC | |||||
ccRCC | |||||
GBM | 0.707 | ||||
HNSC | |||||
LUAD | -0.707 | ||||
LUSC | |||||
non_ccRCC | |||||
PDAC | |||||
UCEC |
BCL2L13-Ser426 | |||||
---|---|---|---|---|---|
Cancer | Intensity | ||||
BRCA | |||||
COAD | |||||
HGSC | |||||
ccRCC | |||||
GBM | -0.707 | ||||
HNSC | |||||
LUAD | 0.707 | ||||
LUSC | |||||
non_ccRCC | |||||
PDAC | |||||
UCEC |
BCL2L13-Ser434 | |||||
---|---|---|---|---|---|
Cancer | Intensity | ||||
BRCA | |||||
COAD | |||||
HGSC | |||||
ccRCC | -0.729 | ||||
GBM | |||||
HNSC | -0.126 | ||||
LUAD | |||||
LUSC | -0.605 | ||||
non_ccRCC | -0.275 | ||||
PDAC | 1.735 | ||||
UCEC |
BCL2L13-Ser444 | |||||
---|---|---|---|---|---|
Cancer | Intensity | ||||
BRCA | -2.092 | ||||
COAD | 0.9 | ||||
HGSC | -0.546 | ||||
ccRCC | -0.271 | ||||
GBM | |||||
HNSC | -0.516 | ||||
LUAD | |||||
LUSC | 0.329 | ||||
non_ccRCC | 0.352 | ||||
PDAC | 1.271 | ||||
UCEC | 0.573 |
BCL2L13-Ser450 | |||||
---|---|---|---|---|---|
Cancer | Intensity | ||||
BRCA | -0.476 | ||||
COAD | 1.017 | ||||
HGSC | -1.857 | ||||
ccRCC | -0.033 | ||||
GBM | |||||
HNSC | -0.184 | ||||
LUAD | |||||
LUSC | -0.52 | ||||
non_ccRCC | 1.554 | ||||
PDAC | 0.723 | ||||
UCEC | -0.225 |
BCL2L13-Ser453 | |||||
---|---|---|---|---|---|
Cancer | Intensity | ||||
BRCA | |||||
COAD | 0.479 | ||||
HGSC | -1.471 | ||||
ccRCC | |||||
GBM | |||||
HNSC | |||||
LUAD | |||||
LUSC | |||||
non_ccRCC | 0.735 | ||||
PDAC | |||||
UCEC | 0.256 |
BCL2L13-Ser468 | |||||
---|---|---|---|---|---|
Cancer | Intensity | ||||
BRCA | |||||
COAD | -0.707 | ||||
HGSC | 0.707 | ||||
ccRCC | |||||
GBM | |||||
HNSC | |||||
LUAD | |||||
LUSC | |||||
non_ccRCC | |||||
PDAC | |||||
UCEC |
BCL2L13-Thr429 | |||||
---|---|---|---|---|---|
Cancer | Intensity | ||||
BRCA | |||||
COAD | |||||
HGSC | |||||
ccRCC | -0.707 | ||||
GBM | |||||
HNSC | 0.707 | ||||
LUAD | |||||
LUSC | |||||
non_ccRCC | |||||
PDAC | |||||
UCEC |
BCL2L13-Thr431 | |||||
---|---|---|---|---|---|
Cancer | Intensity | ||||
BRCA | |||||
COAD | |||||
HGSC | |||||
ccRCC | -0.707 | ||||
GBM | |||||
HNSC | 0.707 | ||||
LUAD | |||||
LUSC | |||||
non_ccRCC | |||||
PDAC | |||||
UCEC |
BCL2L14-Ser135 | |||||
---|---|---|---|---|---|
Cancer | Intensity | ||||
BRCA | -0.901 | ||||
COAD | 0.578 | ||||
HGSC | |||||
ccRCC | |||||
GBM | |||||
HNSC | |||||
LUAD | |||||
LUSC | -1.232 | ||||
non_ccRCC | |||||
PDAC | 0.522 | ||||
UCEC | 1.032 |
BCL2L14-Ser44 | |
---|---|
Cancer | Intensity |
BRCA | |
COAD | 0.973 |
HGSC | |
ccRCC | |
GBM | |
HNSC | -1.491 |
LUAD | |
LUSC | -0.305 |
non_ccRCC | |
PDAC | 0.857 |
UCEC | -0.034 |
PTM-Disease Association:
source: PTMDResidue | Position | State | Disease | Class | PMID |
---|---|---|---|---|---|
S | 70 | A | Cancer | Phosphorylation | 32188705 |
S | 70 | U | Lung cancer/carcinoma | Phosphorylation | 23514933 |
S | 70 | U | Prostate cancer | Phosphorylation | 35013120 |
State Note: Based on the distinct PTM states in diseases, PTMD classified all disease-associated PTMs into six classes, including whether the up-regulation (U) or down-regulation (D) of PTM levels, the absence (A) or presence (P) of PTMs, and the creation (C) or disruption (N) of PTM sites are associated with diseases.
PTM-Drug Perturbation Response:
source: DecryptMNo data.
Function score:
source: funscoRNo data.