| Id: | acc1201 |
| Group: | 2sens |
| Protein: | Bax |
| Gene Symbol: | BAX |
| Protein Id: | Q07812 |
| Protein Name: | BAX_HUMAN |
| PTM: | phosphorylation |
| Site: | Ser184 |
| Site Sequence: | IFVAGVLTASLTIWKKMG--- |
| Disease Category: | Cancer |
| Disease: | Lung Cancer |
| Disease Subtype: | NSCLC |
| Disease Cellline: | A549 |
| Disease Info: | |
| Drug: | Okadaic acid |
| Drug Info: | "Okadaic acid (OA) is a polyether marine biotoxin that inhibits protein phosphatases, leading to diarrhetic shellfish poisoning (DSP) and primarily found in dinoflagellates and contaminated shellfish." |
| Relation: |
Okadaic acid
➜
Bax-Ser184
UP
➜
Lung Cancer
Aggravate
|
| Effect: | modulate |
| Effect Info: | Treatment of cells with okadaic acid or expression of small T antigen can lead to Bax phosphorylation and enhance cell survival. |
| Note: | |
| Score: | 4.0 |
| Pubmed(PMID): | 16679323 |
| Sentence Index: | 16679323_2-3 |
| Sentence: | "We have recently discovered that Bax phosphorylation at serine 184 induced by nicotine through activation of protein kinase AKT abolishes its proapoptotic function in human lung cancer cells. Here we found that either treatment of cells with the protein phosphatase 2A (PP2A) inhibitor okadaic acid or specific disruption of PP2A activity by expression of SV40 small tumor antigen enhanced Bax phosphorylation, whereas C(2)-ceramide, a potent PP2A activator, reduced nicotine-induced Bax phosphorylation, suggesting that PP2A may function as a physiological Bax phosphatase. Treatment of Cells with Okadaic Acid or Expression of Small T Antigen Results in Bax Phosphorylation and Enhanced Cell Survival." |
Sequence & Structure:
MDGSGEQPRGGGPTSSEQIMKTGALLLQGFIQDRAGRMGGEAPELALDPVPQDASTKKLSECLKRIGDELDSNMELQRMIAAVDTDSPREVFFRVAADMFSDGNFNWGRVVALFYFASKLVLKALCTKVPELIRTIMGWTLDFLRERLLGWIQDQGGWDGLLSYFGTPTWQTVTIFVAGVLTASLTIWKKMG
Select PDB:
No data.
Protein Tractability:
source: Open TargetsPTM Intensity:
source: CPTACNo data.
PTM-Disease Association:
source: PTMD| Residue | Position | State | Disease | Class | PMID |
|---|---|---|---|---|---|
| - | - | U | Gastric cancer | Ubiquitination | 37697039 |
State Note: Based on the distinct PTM states in diseases, PTMD classified all disease-associated PTMs into six classes, including whether the up-regulation (U) or down-regulation (D) of PTM levels, the absence (A) or presence (P) of PTMs, and the creation (C) or disruption (N) of PTM sites are associated with diseases.
PTM-Drug Perturbation Response:
source: DecryptMNo data.
Function score:
source: funscoRNo data.
