Id: acc1201
Group: 2sens
Protein: Bax
Gene Symbol: BAX
Protein Id: Q07812
Protein Name: BAX_HUMAN
PTM: phosphorylation
Site: Ser184
Site Sequence: IFVAGVLTASLTIWKKMG---
Disease Category: Cancer
Disease: Lung Cancer
Disease Subtype: NSCLC
Disease Cellline: A549
Disease Info:
Drug: Okadaic acid
Drug Info: "Okadaic acid (OA) is a polyether marine biotoxin that inhibits protein phosphatases, leading to diarrhetic shellfish poisoning (DSP) and primarily found in dinoflagellates and contaminated shellfish."
Relation:
Okadaic acid
Bax-Ser184 UP
Lung Cancer Aggravate
Effect: modulate
Effect Info: Treatment of cells with okadaic acid or expression of small T antigen can lead to Bax phosphorylation and enhance cell survival.
Note:
Score: 4.0
Pubmed(PMID): 16679323
Sentence Index:
Sentence:

Sequence & Structure:

MDGSGEQPRGGGPTSSEQIMKTGALLLQGFIQDRAGRMGGEAPELALDPVPQDASTKKLSECLKRIGDELDSNMELQRMIAAVDTDSPREVFFRVAADMFSDGNFNWGRVVALFYFASKLVLKALCTKVPELIRTIMGWTLDFLRERLLGWIQDQGGWDGLLSYFGTPTWQTVTIFVAGVLTASLTIWKKMG

Select PDB:

Known Drugs:

source: Multi-Sources

(see table)

No data.

Protein Tractability:

source: Open Targets
Small molecule
Antibody
PROTAC
Other modalities
Approved Drug
Advanced Clinical
Phase 1 Clinical
Structure with Ligand
High-Quality Ligand
High-Quality Pocket
Med-Quality Pocket
Druggable Family
Approved Drug
Advanced Clinical
Phase 1 Clinical
UniProt loc high conf
GO CC high conf
UniProt loc med conf
UniProt SigP or TMHMM
GO CC med conf
Human Protein Atlas loc
Approved Drug
Advanced Clinical
Phase 1 Clinical
Literature
UniProt Ubiquitination
Database Ubiquitination
Half-life Data
Small Molecule Binder
Approved Drug
Advanced Clinical
Phase 1 Clinical

PTM Intensity:

source: CPTAC

No data.

PTM-Disease Association:

source: PTMD
Residue Position State Disease Class PMID
- - U Gastric cancer Ubiquitination 37697039

State Note: Based on the distinct PTM states in diseases, PTMD classified all disease-associated PTMs into six classes, including whether the up-regulation (U) or down-regulation (D) of PTM levels, the absence (A) or presence (P) of PTMs, and the creation (C) or disruption (N) of PTM sites are associated with diseases.

PTM-Drug Perturbation Response:

source: DecryptM

No data.

Function score:

source: funscoR

No data.

Cross Links: