Id: | acc1200 |
Group: | 2sens_supp |
Protein: | Bax |
Gene Symbol: | BAX |
Protein Id: | Q07812 |
Protein Name: | BAX_HUMAN |
PTM: | phosphorylation |
Site: | Ser184 |
Site Sequence: | IFVAGVLTASLTIWKKMG--- |
Disease Category: | Cancer |
Disease: | Lung Cancer |
Disease Subtype: | NSCLC |
Disease Cellline: | A549 |
Disease Info: | |
Drug: | Ceramide |
Drug Info: | "Ceramide is a lipid molecule naturally present in the stratum corneum of the skin, essential for maintaining barrier function, moisture retention, and cellular signaling, with applications in skincare and potential therapeutic roles in modulating apoptosis and immune responses." |
Relation: |
Ceramide
➜
Bax-Ser184
DOWN
➜
Lung Cancer
Alleviate
|
Effect: | modulate |
Effect Info: | Ceramide inhibits nicotine-induced phosphorylation of Bax and enhances apoptosis. |
Note: | |
Score: | 4.0 |
Pubmed(PMID): | 16679323 |
Sentence Index: | 16679323_2-3 |
Sentence: | "We have recently discovered that Bax phosphorylation at serine 184 induced by nicotine through activation of protein kinase AKT abolishes its proapoptotic function in human lung cancer cells. Here we found that either treatment of cells with the protein phosphatase 2A (PP2A) inhibitor okadaic acid or specific disruption of PP2A activity by expression of SV40 small tumor antigen enhanced Bax phosphorylation, whereas C(2)-ceramide, a potent PP2A activator, reduced nicotine-induced Bax phosphorylation, suggesting that PP2A may function as a physiological Bax phosphatase. Ceramide Inhibits Nicotine-induced Bax Phosphorylation and Enhances Apoptosis." |
Sequence & Structure:
MDGSGEQPRGGGPTSSEQIMKTGALLLQGFIQDRAGRMGGEAPELALDPVPQDASTKKLSECLKRIGDELDSNMELQRMIAAVDTDSPREVFFRVAADMFSDGNFNWGRVVALFYFASKLVLKALCTKVPELIRTIMGWTLDFLRERLLGWIQDQGGWDGLLSYFGTPTWQTVTIFVAGVLTASLTIWKKMG
Select PDB:
No data.
Protein Tractability:
source: Open TargetsPTM Intensity:
source: CPTACNo data.
PTM-Disease Association:
source: PTMDResidue | Position | State | Disease | Class | PMID |
---|---|---|---|---|---|
- | - | U | Gastric cancer | Ubiquitination | 37697039 |
State Note: Based on the distinct PTM states in diseases, PTMD classified all disease-associated PTMs into six classes, including whether the up-regulation (U) or down-regulation (D) of PTM levels, the absence (A) or presence (P) of PTMs, and the creation (C) or disruption (N) of PTM sites are associated with diseases.
PTM-Drug Perturbation Response:
source: DecryptMNo data.
Function score:
source: funscoRNo data.