Id: | acc0908 |
Group: | 2sens |
Protein: | ERK2 |
Gene Symbol: | MAPK1 |
Protein Id: | P28482 |
Protein Name: | MK01_HUMAN |
PTM: | phosphorylation |
Site: | Tyr187 |
Site Sequence: | HDHTGFLTEYVATRWYRAPEI |
Disease Category: | Cancer |
Disease: | Breast Cancer |
Disease Subtype: | |
Disease Cellline: | SK-BR-3 |
Disease Info: | |
Drug: | Curcumin + Tricostatin A |
Drug Info: | "Curcumin is a natural polyphenolic compound derived from the rhizome of Curcuma longa, known for its anti-inflammatory, antioxidant, and potential anticancer properties. + Tricostatin A (TSA) is a histone deacetylase (HDAC) inhibitor widely used in epigenetic research to modulate gene expression and induce cell differentiation or apoptosis. Tricostatin A (TSA): -" |
Relation: |
Curcumin + Tricostatin A
➜
ERK2-Tyr187
DOWN
➜
Breast Cancer
Alleviate
|
Effect: | modulate |
Effect Info: | "The combination of TSA and curcumin reduced the phosphorylation of ERK and Akt, and induced the phosphorylation of p38 and JNK, thereby enhancing the anticancer effect of TSA." |
Note: | "drug comb, site unclear" |
Score: | 4.0 |
Pubmed(PMID): | 22290509 |
Sentence Index: | 22290509_5-6 |
Sentence: | "Increasing the concentration of curcumin from 10 to 20 microM enhanced the growth inhibitory effects of the combination in SkBr3 and 435eB breast cancer cells, which was accompanied by decreased viability along with decreased phosphorylation of ERK and Akt. The decreased cell viability observed in SkBr3 cells when curcumin was combined with TSA led to a G0/G1 cell cycle arrest and increased p21 and p27, and decreased Cyclin D1 protein expression." |
Sequence & Structure:
MAAAAAAGAGPEMVRGQVFDVGPRYTNLSYIGEGAYGMVCSAYDNVNKVRVAIKKISPFEHQTYCQRTLREIKILLRFRHENIIGINDIIRAPTIEQMKDVYIVQDLMETDLYKLLKTQHLSNDHICYFLYQILRGLKYIHSANVLHRDLKPSNLLLNTTCDLKICDFGLARVADPDHDHTGFLTEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEMLSNRPIFPGKHYLDQLNHILGILGSPSQEDLNCIINLKARNYLLSLPHKNKVPWNRLFPNADSKALDLLDKMLTFNPHKRIEVEQALAHPYLEQYYDPSDEPIAEAPFKFDMELDDLPKEKLKELIFEETARFQPGYRS
Select PDB:
Target | Drug name | MOA | Phase | Status | Disease | Source |
---|---|---|---|---|---|---|
MAPK1 | ULIXERTINIB | MAP kinase ERK2 inhibitor | 2 | Terminated | neoplasm | ClinicalTrials |
MAPK1 | TEMUTERKIB | Mitogen-activated protein kinase; ERK1/ERK2 inhibitor | 2 | Completed | pancreatic carcinoma | ClinicalTrials |
MAPK1 | ULIXERTINIB | MAP kinase ERK2 inhibitor | 2 | Recruiting | histiocytic neoplasm | ClinicalTrials |
MAPK1 | ULIXERTINIB | MAP kinase ERK2 inhibitor | 2 | Active, not recruiting | Uveal Melanoma | ClinicalTrials |
MAPK1 | TEMUTERKIB | Mitogen-activated protein kinase; ERK1/ERK2 inhibitor | 2 | Terminated | cancer | ClinicalTrials |
MAPK1 | ULIXERTINIB | MAP kinase ERK2 inhibitor | 1 | Completed | acute myeloid leukemia | ClinicalTrials |
MAPK1 | ULIXERTINIB | MAP kinase ERK2 inhibitor | 1 | Completed | myelodysplastic syndrome | ClinicalTrials |
MAPK1 | TEMUTERKIB | Mitogen-activated protein kinase; ERK1/ERK2 inhibitor | 1 | Recruiting | acute myeloid leukemia | ClinicalTrials |
MAPK1 | ULIXERTINIB | MAP kinase ERK2 inhibitor | 1 | Completed | neoplasm | ClinicalTrials ClinicalTrials |
MAPK1 | MK-8353 | MAP kinase ERK2 inhibitor | 1 | Completed | neoplasm | ClinicalTrials |
MAPK1 | RAVOXERTINIB | MAP kinase ERK2 inhibitor | 1 | Completed | neoplasm | ClinicalTrials |
MAPK1 | MK-8353 | MAP kinase ERK2 inhibitor | 1 | Terminated | neoplasm | ClinicalTrials |
MAPK1 | ULIXERTINIB | MAP kinase ERK2 inhibitor | 1 | Recruiting | pancreatic carcinoma | ClinicalTrials |
MAPK1 | ULIXERTINIB | MAP kinase ERK2 inhibitor | 1 | Terminated | pancreatic carcinoma | ClinicalTrials |
MAPK1 | ULIXERTINIB | MAP kinase ERK2 inhibitor | 1 | Recruiting | metastatic colorectal cancer | ClinicalTrials |
MAPK1 | KO-947 | Mitogen-activated protein kinase; ERK1/ERK2 inhibitor | 1 | Terminated | cancer | ClinicalTrials |
MAPK1 | MK-8353 | MAP kinase ERK2 inhibitor | 1 | Completed | colorectal cancer | ClinicalTrials |
MAPK1 | TEMUTERKIB | Mitogen-activated protein kinase; ERK1/ERK2 inhibitor | 0.5 | Recruiting | glioblastoma multiforme | ClinicalTrials |
MAPK1 | ULIXERTINIB | MAP kinase ERK2 inhibitor | 0.5 | Recruiting | Paraganglioma | ClinicalTrials |
Note: Only show clinically investigational or approved drugs with protein targets.
Protein Tractability:
source: Open TargetsPTM Intensity:
source: CPTACMAPK1-Tyr187 | |
---|---|
Cancer | Intensity |
BRCA | 0.772 |
COAD | 0.273 |
HGSC | 0.701 |
ccRCC | -0.806 |
GBM | 0.279 |
HNSC | 0.328 |
LUAD | 0.387 |
LUSC | 0.866 |
non_ccRCC | -2.593 |
PDAC | 0.32 |
UCEC | -0.527 |
PTM-Disease Association:
source: PTMDResidue | Position | State | Disease | Class | PMID |
---|---|---|---|---|---|
Y | 187 | U | Thyroid cancer/carcinoma | Phosphorylation | 17209045 |
Y | 187 | U | Triple-negative breast cancer | Phosphorylation | 28415597 |
State Note: Based on the distinct PTM states in diseases, PTMD classified all disease-associated PTMs into six classes, including whether the up-regulation (U) or down-regulation (D) of PTM levels, the absence (A) or presence (P) of PTMs, and the creation (C) or disruption (N) of PTM sites are associated with diseases.
PTM-Drug Perturbation Response:
source: DecryptMProtein | Gene | PTM | Position | Modified sequence | Cell | Drug | pEC50 | Regulation | Experiment |
---|---|---|---|---|---|---|---|---|---|
P28482 | MAPK1 | P | Tyr187 | VADPDHDHTGFLTEY(ph)VATR | A431 | Imatinib | 5.4775 | up | |
P28482 | MAPK1 | P | Tyr187 | VADPDHDHTGFLTEY(ph)VATR | BT-474 | Lapatinib | 6.6172 | down | |
P28482 | MAPK1 | P | Tyr187 | VADPDHDHTGFLTEY(ph)VATR | K562 | Dasatinib | 8.8776 | down | |
P28482 | MAPK1 | P | Tyr187 | VADPDHDHTGFLTEY(ph)VATR | KYSE-520 | SHP099 | 6.2002 | down | |
P28482 | MAPK1 | P | Tyr187 | VADPDHDHTGFLTEY(ph)VATR | MDA-MB-175 | Lapatinib | 7.3646 | down | |
P28482 | MAPK1 | P | Tyr187 | VADPDHDHTGFLTEY(ph)VATR | MDA-MB-175 | Pertuzumab | -4.632 | down | |
P28482 | MAPK1 | P | Tyr187 | VADPDHDHTGFLTEY(ph)VATR | PC-9 | LapatinibAZD4547 | 6.4194 | down | |
P28482 | MAPK1 | P | Tyr187 | VADPDHDHTGFLTEY(ph)VATR | PC-9 | Lapatinib | 6.4558 | down | |
P28482 | MAPK1 | P | Thr185;Tyr187 | VADPDHDHTGFLT(ph)EY(ph)VATR | SK-BR-3 | Trastuzumab | -1.2287 | - | |
P28482 | MAPK1 | P | Tyr187 | VADPDHDHTGFLTEY(ph)VATR | A431 | Dasatinib | 6.1777 | - | |
P28482 | MAPK1 | P | Tyr187 | VADPDHDHTGFLTEY(ph)VATR | SK-BR-3 | Trastuzumab | -0.81 | - | |
P28482 | MAPK1 | P | Tyr187 | VADPDHDHTGFLTEY(ph)VATR | SK-BR-3 | Pertuzumab | -1.7704 | - | |
P28482 | MAPK1 | P | Tyr187 | VADPDHDHTGFLTEY(ph)VATR | SK-BR-3 | Lapatinib | 4.7218 | - | |
P28482 | MAPK1 | P | Tyr187;Thr190 | VADPDHDHTGFLTEY(ph)VAT(ph)R | PC-9 | AZD4547 | 1.938 | - | |
P28482 | MAPK1 | P | Tyr187 | VADPDHDHTGFLTEY(ph)VATR | PC-9 | AZD4547 | 7.196 | - | |
P28482 | MAPK1 | P | Thr185;Tyr187 | VADPDHDHTGFLT(ph)EY(ph)VATR | PC-9 | AZD4547 | 7.2923 | - | |
P28482 | MAPK1 | P | Thr185;Tyr187 | VADPDHDHTGFLT(ph)EY(ph)VATR | MDA-MB-175 | Trastuzumab | -1.6811 | - | |
P28482 | MAPK1 | P | Tyr187 | VADPDHDHTGFLTEY(ph)VATR | MDA-MB-175 | Trastuzumab | 5 | - | |
P28482 | MAPK1 | P | Tyr187 | VADPDHDHTGFLTEY(ph)VATR | K562 | Imatinib | 7.13 | - | |
P28482 | MAPK1 | P | Tyr187 | VADPDHDHTGFLTEY(ph)VATR | BT-474 | Trastuzumab | -2.1745 | - | |
P28482 | MAPK1 | P | Tyr187 | VADPDHDHTGFLTEY(ph)VATR | BT-474 | Pertuzumab | -1.9633 | - |
pEC50 Note: pEC50 is the negative logarithm of EC50 (half-maximal effective concentration, dosage unit Mol), calculated as pEC50 = -log10(EC50), which quantifies the potency of a drug or compound.
Function score:
source: funscoRNo data.