Id: | acc0784 |
Group: | 2sens |
Protein: | Smad3 |
Gene Symbol: | SMAD3 |
Protein Id: | P84022 |
Protein Name: | SMAD3_HUMAN |
PTM: | phosphorylation |
Site: | Ser425 |
Site Sequence: | SPSIRCSSVS----------- |
Disease Category: | Cancer |
Disease: | Prostate Cancer |
Disease Subtype: | |
Disease Cellline: | PC3-M |
Disease Info: | |
Drug: | Apigenin |
Drug Info: | "Apigenin is a naturally occurring flavonoid compound with demonstrated potential as an antifungal agent in the preparation of drugs against human fungal infections, and it is also being researched in drug delivery systems such as solid lipid nanoparticles (APG-SLNP) to enhance stability and bioavailability. " |
Relation: |
Apigenin
➜
Smad3-Ser425
DOWN
➜
Prostate Cancer
Alleviate
|
Effect: | modulate |
Effect Info: | "Apigenin inhibits prostate carcinogenesis by suppressing the phosphorylation of Smad2/3, Src, FAK, and Akt." |
Note: | |
Score: | 4.0 |
Pubmed(PMID): | 23359392 |
Sentence Index: | 23359392_11-12 |
Sentence: | "Furthermore, constitutively active Src reversed the inhibitory effect of apigenin on VEGF expression and Smad2/3 phosphorylation. Taken together, our results suggest that apigenin inhibits prostate carcinogenesis by modulating TGF-beta-activated pathways linked to cancer progression and metastases, in particular the Smad2/3 and Src/FAK/Akt pathways." |
Sequence & Structure:
MSSILPFTPPIVKRLLGWKKGEQNGQEEKWCEKAVKSLVKKLKKTGQLDELEKAITTQNVNTKCITIPRSLDGRLQVSHRKGLPHVIYCRLWRWPDLHSHHELRAMELCEFAFNMKKDEVCVNPYHYQRVETPVLPPVLVPRHTEIPAEFPPLDDYSHSIPENTNFPAGIEPQSNIPETPPPGYLSEDGETSDHQMNHSMDAGSPNLSPNPMSPAHNNLDLQPVTYCEPAFWCSISYYELNQRVGETFHASQPSMTVDGFTDPSNSERFCLGLLSNVNRNAAVELTRRHIGRGVRLYYIGGEVFAECLSDSAIFVQSPNCNQRYGWHPATVCKIPPGCNLKIFNNQEFAALLAQSVNQGFEAVYQLTRMCTIRMSFVKGWGAEYRRQTVTSTPCWIELHLNGPLQWLDKVLTQMGSPSIRCSSVS
Select PDB:
No data.
Protein Tractability:
source: Open TargetsPTM Intensity:
source: CPTACNo data.
PTM-Disease Association:
source: PTMDResidue | Position | State | Disease | Class | PMID |
---|---|---|---|---|---|
K | 333 | D | Nonalcoholic steatohepatitis | Acetylation | 32305562 |
K | 341 | D | Renal fibrosis | Acetylation | 37777567 |
K | 378 | D | Nonalcoholic steatohepatitis | Acetylation | 32305562 |
K | 378 | D | Renal fibrosis | Acetylation | 37777567 |
K | 20 | U | Triple-negative breast cancer | Acetylation | 34392614 |
K | 117 | U | Triple-negative breast cancer | Acetylation | 34392614 |
K | 333 | U | Melanoma | Acetylation | 29520103 |
K | 53 | U | Cancer | Methylation | 35085106 |
K | 333 | U | Cancer | Methylation | 35085106 |
T | 179 | U | Breast cancer | Phosphorylation | 33051597 |
S | 213 | U | Prostate cancer | Phosphorylation | 36536346 |
State Note: Based on the distinct PTM states in diseases, PTMD classified all disease-associated PTMs into six classes, including whether the up-regulation (U) or down-regulation (D) of PTM levels, the absence (A) or presence (P) of PTMs, and the creation (C) or disruption (N) of PTM sites are associated with diseases.
PTM-Drug Perturbation Response:
source: DecryptMNo data.
Function score:
source: funscoRNo data.