Id: | acc0736 |
Group: | 2sens |
Protein: | GD3 |
Gene Symbol: | ST8SIA1 |
Protein Id: | Q92185 |
Protein Name: | SIA8A_HUMAN |
PTM: | acetylation |
Site: | unclear |
Site Sequence: | |
Disease Category: | Cancer |
Disease: | Medulloblastoma |
Disease Subtype: | |
Disease Cellline: | RES256 |
Disease Info: | |
Drug: | Etoposide |
Drug Info: | "Etoposide is a chemotherapeutic agent that inhibits topoisomerase II, leading to DNA strand breaks and apoptosis, and is used in the treatment of various cancers including small cell lung cancer, testicular cancer, and lymphomas, administered intravenously or orally." |
Relation: |
GD3-unclear
DOWN
+
Etoposide
➜
Medulloblastoma
Alleviate
|
Effect: | inhibit |
Effect Info: | "SIAE reduces the acetylation of GD3, leading to an increased expression of GD3, which in turn increases the sensitivity of medulloblastoma cell lines to etoposide." |
Note: | |
Score: | 5.0 |
Pubmed(PMID): | 31197190 |
Sentence Index: | 31197190_11-12 |
Sentence: | Presence of these gangliosides has previously been shown to correlate with resistance to chemotherapy. Here we show that the GD3 acetylation pathway is dysregulated in MB and as a proof-of-principle we show that increased GD3 expression sensitises an MB cell line to etoposide. |
Sequence & Structure:
MSPCGRARRQTSRGAMAVLAWKFPRTRLPMGASALCVVVLCWLYIFPVYRLPNEKEIVQGVLQQGTAWRRNQTAARAFRKQMEDCCDPAHLFAMTKMNSPMGKSMWYDGEFLYSFTIDNSTYSLFPQATPFQLPLKKCAVVGNGGILKKSGCGRQIDEANFVMRCNLPPLSSEYTKDVGSKSQLVTANPSIIRQRFQNLLWSRKTFVDNMKIYNHSYIYMPAFSMKTGTEPSLRVYYTLSDVGANQTVLFANPNFLRSIGKFWKSRGIHAKRLSTGLFLVSAALGLCEEVAIYGFWPFSVNMHEQPISHHYYDNVLPFSGFHAMPEEFLQLWYLHKIGALRMQLDPCEDTSLQPTS
No data.
No data.
Protein Tractability:
source: Open TargetsPTM Intensity:
source: CPTACNo data.
PTM-Disease Association:
source: PTMDNo data.
PTM-Drug Perturbation Response:
source: DecryptMNo data.
Function score:
source: funscoRNo data.