Id: | acc0733 |
Group: | 2sens |
Protein: | FOXO1 |
Gene Symbol: | FOXO1 |
Protein Id: | Q12778 |
Protein Name: | FOXO1_HUMAN |
PTM: | phosphorylation |
Site: | Thr24 |
Site Sequence: | EPLPRPRSCTWPLPRPEFSQS |
Disease Category: | Cancer |
Disease: | Lung Cancer |
Disease Subtype: | NSCLC |
Disease Cellline: | H1650 |
Disease Info: | |
Drug: | Ku0063794 + Erlotinib |
Drug Info: | "Ku-0063794 is a cell-permeable, selective dual inhibitor of mTORC1 and mTORC2 with an IC50 of 10 nM, which induces G1-cell cycle arrest and autophagy, and inhibits tumor growth in renal cell carcinoma xenograft models. Erlotinib is a direct-acting EGFR tyrosine kinase inhibitor with an IC50 of 2 nM for human EGFR, used in the treatment of non-small cell lung cancer (NSCLC) by reducing EGFR autophosphorylation in intact tumor cells. " |
Relation: |
Ku0063794 + Erlotinib
➜
FOXO1-Thr24
DOWN
➜
Lung Cancer
Alleviate
|
Effect: | modulate |
Effect Info: | "In TKI-resistant cells, the mTOR–AKT–FOXO1 signaling pathway is dysregulated, with increased FOXO1 phosphorylation levels and decreased acetylation levels. The combined use of mTOR or PI4K inhibitors with erlotinib can overcome TKI resistance, inhibit cell proliferation, and induce apoptosis." |
Note: | drug comb |
Score: | 4.0 |
Pubmed(PMID): | 26036758 |
Sentence Index: | 26036758_10-11 |
Sentence: | "Importantly, increasing FOXO1 acetylation by a HDAC inhibitor, depsipeptide, overcomes TKI resistance to effectively induce TKI-resistant NSCLC cell apoptosis. Together, FOXO1 plays dual roles in TKI resistance through posttranslational modifications in NSCLC and this study provides a possible strategy for treatment of TKI-resistant NSCLC patients." |
Sequence & Structure:
MAEAPQVVEIDPDFEPLPRPRSCTWPLPRPEFSQSNSATSSPAPSGSAAANPDAAAGLPSASAAAVSADFMSNLSLLEESEDFPQAPGSVAAAVAAAAAAAATGGLCGDFQGPEAGCLHPAPPQPPPPGPLSQHPPVPPAAAGPLAGQPRKSSSSRRNAWGNLSYADLITKAIESSAEKRLTLSQIYEWMVKSVPYFKDKGDSNSSAGWKNSIRHNLSLHSKFIRVQNEGTGKSSWWMLNPEGGKSGKSPRRRAASMDNNSKFAKSRSRAAKKKASLQSGQEGAGDSPGSQFSKWPASPGSHSNDDFDNWSTFRPRTSSNASTISGRLSPIMTEQDDLGEGDVHSMVYPPSAAKMASTLPSLSEISNPENMENLLDNLNLLSSPTSLTVSTQSSPGTMMQQTPCYSFAPPNTSLNSPSPNYQKYTYGQSSMSPLPQMPIQTLQDNKSSYGGMSQYNCAPGLLKELLTSDSPPHNDIMTPVDPGVAQPNSRVLGQNVMMGPNSVMSTYGSQASHNKMMNPSSHTHPGHAQQTSAVNGRPLPHTVSTMPHTSGMNRLTQVKTPVQVPLPHPMQMSALGGYSSVSSCNGYGRMGLLHQEKLPSDLDGMFIERLDCDMESIIRNDLMDGDTLDFNFDNVLPNQSFPHSVKTTTHSWVSG
Select PDB:
No data.
Protein Tractability:
source: Open TargetsPTM Intensity:
source: CPTACNo intensity data of this site,
show all other sites!
FOXO1-Ser218 | |||||
---|---|---|---|---|---|
Cancer | Intensity | ||||
BRCA | 1.611 | ||||
COAD | |||||
HGSC | |||||
ccRCC | |||||
GBM | -0.033 | ||||
HNSC | |||||
LUAD | |||||
LUSC | -0.786 | ||||
non_ccRCC | |||||
PDAC | -0.882 | ||||
UCEC | 0.089 |
FOXO1-Ser256 | |||||
---|---|---|---|---|---|
Cancer | Intensity | ||||
BRCA | -0.041 | ||||
COAD | |||||
HGSC | 1.442 | ||||
ccRCC | |||||
GBM | -0.737 | ||||
HNSC | 0.067 | ||||
LUAD | -0.248 | ||||
LUSC | -0.693 | ||||
non_ccRCC | 1.745 | ||||
PDAC | -0.217 | ||||
UCEC | -1.318 |
FOXO1-Ser276 | |||||
---|---|---|---|---|---|
Cancer | Intensity | ||||
BRCA | 1.669 | ||||
COAD | |||||
HGSC | |||||
ccRCC | |||||
GBM | 0.177 | ||||
HNSC | 0.233 | ||||
LUAD | 0.118 | ||||
LUSC | -0.216 | ||||
non_ccRCC | |||||
PDAC | -0.248 | ||||
UCEC | -1.734 |
FOXO1-Ser279 | |||||
---|---|---|---|---|---|
Cancer | Intensity | ||||
BRCA | |||||
COAD | |||||
HGSC | |||||
ccRCC | -0.926 | ||||
GBM | |||||
HNSC | -0.135 | ||||
LUAD | 1.061 | ||||
LUSC | |||||
non_ccRCC | |||||
PDAC | |||||
UCEC |
FOXO1-Ser287 | |||||
---|---|---|---|---|---|
Cancer | Intensity | ||||
BRCA | 0.191 | ||||
COAD | 0.213 | ||||
HGSC | -2.766 | ||||
ccRCC | 0.482 | ||||
GBM | 0.205 | ||||
HNSC | 0.041 | ||||
LUAD | 0.127 | ||||
LUSC | 0.229 | ||||
non_ccRCC | 1.379 | ||||
PDAC | 0.042 | ||||
UCEC | -0.142 |
FOXO1-Ser290 | |||||
---|---|---|---|---|---|
Cancer | Intensity | ||||
BRCA | |||||
COAD | 0.707 | ||||
HGSC | |||||
ccRCC | |||||
GBM | |||||
HNSC | |||||
LUAD | |||||
LUSC | |||||
non_ccRCC | |||||
PDAC | |||||
UCEC | -0.707 |
FOXO1-Ser298 | |||||
---|---|---|---|---|---|
Cancer | Intensity | ||||
BRCA | 0.714 | ||||
COAD | -0.074 | ||||
HGSC | |||||
ccRCC | -0.663 | ||||
GBM | -0.928 | ||||
HNSC | -0.11 | ||||
LUAD | 0.011 | ||||
LUSC | 0.835 | ||||
non_ccRCC | 1.974 | ||||
PDAC | -0.162 | ||||
UCEC | -1.597 |
FOXO1-Ser301 | |||||
---|---|---|---|---|---|
Cancer | Intensity | ||||
BRCA | |||||
COAD | |||||
HGSC | |||||
ccRCC | |||||
GBM | 0.966 | ||||
HNSC | -1.031 | ||||
LUAD | 0.065 | ||||
LUSC | |||||
non_ccRCC | |||||
PDAC | |||||
UCEC |
FOXO1-Ser303 | |||||
---|---|---|---|---|---|
Cancer | Intensity | ||||
BRCA | |||||
COAD | |||||
HGSC | |||||
ccRCC | |||||
GBM | -0.653 | ||||
HNSC | 1.461 | ||||
LUAD | |||||
LUSC | |||||
non_ccRCC | |||||
PDAC | -0.642 | ||||
UCEC | -0.166 |
FOXO1-Ser319 | |||||
---|---|---|---|---|---|
Cancer | Intensity | ||||
BRCA | |||||
COAD | 0.846 | ||||
HGSC | -1.441 | ||||
ccRCC | |||||
GBM | 0.423 | ||||
HNSC | |||||
LUAD | |||||
LUSC | |||||
non_ccRCC | |||||
PDAC | |||||
UCEC | 0.172 |
FOXO1-Ser322 | |||||
---|---|---|---|---|---|
Cancer | Intensity | ||||
BRCA | |||||
COAD | 0.707 | ||||
HGSC | -0.707 | ||||
ccRCC | |||||
GBM | |||||
HNSC | |||||
LUAD | |||||
LUSC | |||||
non_ccRCC | |||||
PDAC | |||||
UCEC |
FOXO1-Ser329 | |||||
---|---|---|---|---|---|
Cancer | Intensity | ||||
BRCA | |||||
COAD | 0.095 | ||||
HGSC | -0.665 | ||||
ccRCC | |||||
GBM | 1.377 | ||||
HNSC | |||||
LUAD | |||||
LUSC | |||||
non_ccRCC | |||||
PDAC | |||||
UCEC | -0.808 |
FOXO1-Ser470 | |||||
---|---|---|---|---|---|
Cancer | Intensity | ||||
BRCA | |||||
COAD | -0.366 | ||||
HGSC | 1.256 | ||||
ccRCC | |||||
GBM | |||||
HNSC | 0.224 | ||||
LUAD | |||||
LUSC | |||||
non_ccRCC | |||||
PDAC | |||||
UCEC | -1.113 |
FOXO1-Thr478 | |
---|---|
Cancer | Intensity |
BRCA | |
COAD | |
HGSC | -0.707 |
ccRCC | |
GBM | |
HNSC | |
LUAD | |
LUSC | |
non_ccRCC | |
PDAC | |
UCEC | 0.707 |
PTM-Disease Association:
source: PTMDResidue | Position | State | Disease | Class | PMID |
---|---|---|---|---|---|
T | 24 | D | Head and neck squamous cell carcinoma | Phosphorylation | 21281788 |
T | 24 | U | Breast cancer | Phosphorylation | 36797347 |
T | 24 | U | Prostate cancer | Phosphorylation | 36720852 |
State Note: Based on the distinct PTM states in diseases, PTMD classified all disease-associated PTMs into six classes, including whether the up-regulation (U) or down-regulation (D) of PTM levels, the absence (A) or presence (P) of PTMs, and the creation (C) or disruption (N) of PTM sites are associated with diseases.
PTM-Drug Perturbation Response:
source: DecryptMNo data.
Function score:
source: funscoRNo data.