Id: acc0724
Group: 2sens
Protein: histone H3
Gene Symbol: H3C1
Protein Id: P68431
Protein Name: H31_HUMAN
PTM: acetylation
Site: Lys9
Site Sequence: -MARTKQTARKSTGGKAPRKQ
Disease Category: Cancer
Disease: Colorectal Cancer
Disease Subtype:
Disease Cellline: HCT116
Disease Info:
Drug: 5-FU
Drug Info: "CUDC-907 is a dual inhibitor of PI3K (phosphoinositide 3-kinase) and HDAC (histone deacetylase), targeting PI3Kalpha/beta/delta with IC50 values of 19/54/39 nM and HDAC1/2/3/10 with IC50 values of 1.7/5.0/1.8/2.8 nM, currently in Phase 1 clinical development for anticancer therapy. "
Relation:
histone H3-Lys9 UP
5-FU
Colorectal Cancer Alleviate
Effect: enhance
Effect Info: "CUDC-907 promotes histone H3 lysine 9 acetylation (H3K9ac) and inhibits AKT phosphorylation (Ser473), thereby suppressing tumors. CUDC-907 sensitizes CRC cells to 5-FU-induced cell death."
Note: "drug comb, histone"
Score: 4.5
Pubmed(PMID): 28139498
Sentence Index:
Sentence:

Sequence & Structure:

MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA

Select PDB:

Known Drugs:

source: Multi-Sources

(see table)

No data.

Protein Tractability:

source: Open Targets

No data.

PTM Intensity:

source: CPTAC

No data.

PTM-Disease Association:

source: PTMD
Residue Position State Disease Class PMID
K 9 D Diabetes mellitus Acetylation 23423566
K 9 D Friedreich's ataxia Acetylation 18045775
K 9 D Prostate cancer Acetylation 19885564
K 9 D Systemic lupus erythematosus Acetylation 36165173
K 9 D Prostate cancer Methylation 19739128
K 9 D Pancreatic carcinoma Methylation 20142597
K 9 U Prostate cancer Acetylation 19935671
K 9 U Diabetes mellitus Acetylation 23423566
K 9 U Gastric adenocarcinoma Acetylation 18470569
K 9 U Type 2 diabetes Acetylation 34944721
K 9 U Breast cancer Methylation 19943104
K 9 U Friedreich's ataxia Methylation 18045775
K 9 U Friedreich's ataxia Methylation 18045775

State Note: Based on the distinct PTM states in diseases, PTMD classified all disease-associated PTMs into six classes, including whether the up-regulation (U) or down-regulation (D) of PTM levels, the absence (A) or presence (P) of PTMs, and the creation (C) or disruption (N) of PTM sites are associated with diseases.

PTM-Drug Perturbation Response:

source: DecryptM

No data.

Function score:

source: funscoR

No data.

Cross Links: