Id: | acc0675 |
Group: | 1sens |
Protein: | YAP |
Gene Symbol: | YAP1 |
Protein Id: | P46937 |
Protein Name: | YAP1_HUMAN |
PTM: | phosphorylation |
Site: | Ser127 |
Site Sequence: | LTPQHVRAHSSPASLQLGAVS |
Disease Category: | Cancer |
Disease: | Ovarian Cancer |
Disease Subtype: | |
Disease Cellline: | ES-2 |
Disease Info: | |
Drug: | Cisplatin |
Drug Info: | "Cisplatin is a platinum-based chemotherapeutic agent widely used in the treatment of various malignancies, including ovarian, bladder, testicular, and non-small cell lung cancers, by forming DNA cross-links to interfere with replication and repair, thereby inhibiting cancer cell growth and proliferation." |
Relation: |
YAP-Ser127
DOWN
+
Cisplatin
➜
Ovarian Cancer
Alleviate
|
Effect: | inhibit |
Effect Info: | "S1PR1 is highly expressed in ovarian cancer tissues and cell lines. Its deficiency inhibits the proliferation and migration of ovarian cancer cells, promotes cell senescence, inhibits YAP phosphorylation, and enhances the sensitivity to cisplatin chemotherapy." |
Note: | |
Score: | 5.0 |
Pubmed(PMID): | 37828220 |
Sentence Index: | 37828220_8 |
Sentence: | "Exposure of ovarian cancer cells to sphingosine-1-phosphate (S1P) increased the expression of 3-phosphatidylinositol-dependent protein kinase 1 (PDK1), decreased the expression of large tumor suppressor 1/2 (LATS1/2), and induced phosphorylation of Yes-associated protein (p-YAP)." |
Sequence & Structure:
MDPGQQPPPQPAPQGQGQPPSQPPQGQGPPSGPGQPAPAATQAAPQAPPAGHQIVHVRGDSETDLEALFNAVMNPKTANVPQTVPMRLRKLPDSFFKPPEPKSHSRQASTDAGTAGALTPQHVRAHSSPASLQLGAVSPGTLTPTGVVSGPAATPTAQHLRQSSFEIPDDVPLPAGWEMAKTSSGQRYFLNHIDQTTTWQDPRKAMLSQMNVTAPTSPPVQQNMMNSASGPLPDGWEQAMTQDGEIYYINHKNKTTSWLDPRLDPRFAMNQRISQSAPVKQPPPLAPQSPQGGVMGGSNSNQQQQMRLQQLQMEKERLRLKQQELLRQAMRNINPSTANSPKCQELALRSQLPTLEQDGGTQNPVSSPGMSQELRTMTTNSSDPFLNSGTYHSRDESTDSGLSMSSYSVPRTPDDFLNSVDEMDTGDTINQSTLPSQQNRFPDYLEAIPGTNVDLGTLEGDGMNIEGEELMPSLQEALSSDILNDMESVLAATKLDKESFLTWL
Select PDB:
No data.
Protein Tractability:
source: Open TargetsPTM Intensity:
source: CPTACYAP1-Ser127 | |
---|---|
Cancer | Intensity |
BRCA | |
COAD | 0.729 |
HGSC | -1.387 |
ccRCC | |
GBM | |
HNSC | 0.735 |
LUAD | -0.077 |
LUSC | |
non_ccRCC | |
PDAC | |
UCEC |
PTM-Disease Association:
source: PTMDResidue | Position | State | Disease | Class | PMID |
---|---|---|---|---|---|
S | 127 | A | Hepatocellular carcinoma/hepatocarcinoma/hepatoma | Phosphorylation | 22761457 |
S | 127 | A | Adult T-cell leukemia/lymphoma | Phosphorylation | 35210364 |
S | 127 | D | Bladder cancer | Phosphorylation | 26119935 |
S | 127 | D | Glioblastoma | Phosphorylation | 34343153 |
S | 127 | D | Prostate cancer | Phosphorylation | 36823643 |
S | 127 | D | Lung cancer/carcinoma | Phosphorylation | 21060948 |
S | 127 | D | Renal cell carcinoma | Phosphorylation | 32926756 |
S | 127 | D | Liver cancer | Phosphorylation | 28474680 |
S | 127 | D | Diabetes mellitus | Phosphorylation | 28474680 |
S | 127 | D | Coronary artery disease | Phosphorylation | 37104914 |
S | 127 | P | Cervical cancer/carcinoma | Phosphorylation | 23027127 |
S | 127 | P | Hepatocellular cancer | Phosphorylation | 35597479 |
S | 127 | P | Colon cancer | Phosphorylation | 34206989 |
S | 127 | U | Hepatocellular cancer | Phosphorylation | 35586495 |
S | 127 | U | Parkinson's disease | Phosphorylation | 32929029 |
S | 127 | U | Osteoarthritis | Phosphorylation | 37100374 |
S | 127 | U | Breast cancer | Phosphorylation | 36774339 |
State Note: Based on the distinct PTM states in diseases, PTMD classified all disease-associated PTMs into six classes, including whether the up-regulation (U) or down-regulation (D) of PTM levels, the absence (A) or presence (P) of PTMs, and the creation (C) or disruption (N) of PTM sites are associated with diseases.
PTM-Drug Perturbation Response:
source: DecryptMNo data.
Function score:
source: funscoRNo data.