Id: | acc0590 |
Group: | 1sens |
Protein: | PHB1 |
Gene Symbol: | PHB1 |
Protein Id: | P35232 |
Protein Name: | PHB1_HUMAN |
PTM: | phosphorylation |
Site: | Thr258 |
Site Sequence: | YQLSRSRNITYLPAGQSVLLQ |
Disease Category: | Cancer |
Disease: | Colorectal Cancer |
Disease Subtype: | |
Disease Cellline: | SW48 |
Disease Info: | |
Drug: | FL3 |
Drug Info: | - |
Relation: |
FL3
➜
PHB1-Thr258
DOWN
➜
Colorectal Cancer
Alleviate
|
Effect: | modulate |
Effect Info: | "FL3 treatment can block the phosphorylation of PHB1 at Thr258, thereby inhibiting tumors." |
Note: | |
Score: | 4.0 |
Pubmed(PMID): | 32665357 |
Sentence Index: | 32665357_10 |
Sentence: | "In colorectal cancer cells, FL3 treatment blocked phosphorylation of PHB1 at Thr258, resulting in its nuclear translocation and binding to the Axin1 promoter." |
Sequence & Structure:
MAAKVFESIGKFGLALAVAGGVVNSALYNVDAGHRAVIFDRFRGVQDIVVGEGTHFLIPWVQKPIIFDCRSRPRNVPVITGSKDLQNVNITLRILFRPVASQLPRIFTSIGEDYDERVLPSITTEILKSVVARFDAGELITQRELVSRQVSDDLTERAATFGLILDDVSLTHLTFGKEFTEAVEAKQVAQQEAERARFVVEKAEQQKKAAIISAEGDSKAAELIANSLATAGDGLIELRKLEAAEDIAYQLSRSRNITYLPAGQSVLLQLPQ
Select PDB:
No data.
Protein Tractability:
source: Open TargetsPTM Intensity:
source: CPTACEPHB1-Ser899 | |
---|---|
Cancer | Intensity |
BRCA | |
COAD | |
HGSC | |
ccRCC | 0.707 |
GBM | -0.707 |
HNSC | |
LUAD | |
LUSC | |
non_ccRCC | |
PDAC | |
UCEC |
PTM-Disease Association:
source: PTMDResidue | Position | State | Disease | Class | PMID |
---|---|---|---|---|---|
T | 258 | U | Cervical adenocarcinoma | Phosphorylation | 22410782 |
State Note: Based on the distinct PTM states in diseases, PTMD classified all disease-associated PTMs into six classes, including whether the up-regulation (U) or down-regulation (D) of PTM levels, the absence (A) or presence (P) of PTMs, and the creation (C) or disruption (N) of PTM sites are associated with diseases.
PTM-Drug Perturbation Response:
source: DecryptMNo data.
Function score:
source: funscoRNo data.