Id: | acc0538 |
Group: | 1sens |
Protein: | SMAD3 |
Gene Symbol: | Smad3 |
Protein Id: | P84025 |
Protein Name: | SMAD3_RAT |
PTM: | phosphorylation |
Site: | Ser425 |
Site Sequence: | SPSIRCSSVS----------- |
Disease Category: | Endocrine and metabolic diseases |
Disease: | Pituitary Tumor |
Disease Subtype: | |
Disease Cellline: | GH3 |
Disease Info: | |
Drug: | Trastuzumab + TGFB1 |
Drug Info: | "Trastuzumab is a recombinant humanized monoclonal antibody targeting HER2 (human epidermal growth factor receptor 2), used for the treatment of HER2-positive breast cancer and gastric cancer. TGFB1: - " |
Relation: |
Trastuzumab + TGFB1
➜
SMAD3-Ser425
UP
➜
Pituitary Tumor
Alleviate
|
Effect: | modulate |
Effect Info: | "Incubation of trastuzumab with TGFB1 induces a significant increase in the expression of p-Smad2/3 and a significant decrease in the phosphorylation of ERK1/2, thereby inhibiting tumor proliferation." |
Note: | drug comb |
Score: | 4.0 |
Pubmed(PMID): | 29875136 |
Sentence Index: | 29875136_6 |
Sentence: | "In tumoral GH3 cells, co-incubation with trastuzumab and TGFB1 significantly decreased cell proliferation, an effect accompanied by a reduction in ERK1/2 phosphorylation, an increase of SMAD2/3 activation." |
Sequence & Structure:
MSSILPFTPPIVKRLLGWKKGEQNGQEEKWCEKAVKSLVKKLKKTGQLDELEKAITTQNVNTKCITIPRSLDGRLQVSHRKGLPHVIYCRLWRWPDLHSHHELRAMELCEFAFNMKKDEVCVNPYHYQRVETPVLPPVLVPRHTEIPAEFPPLDDYSHSIPENTNFPAGIEPQSNIPETPPPGYLSEDGETSDHQMNHSMDAGSPNLSPNPMSPAHNNLDLQPVTYCEPAFWCSISYYELNQRVGETFHASQPSMTVDGFTDPSNSERFCLGLLSNVNRNAAVELTRRHIGRGVRLYYIGGEVFAECLSDSAIFVQSPNCNQRYGWHPATVCKIPPGCNLKIFNNQEFAALLAQSVNQGFEAVYQLTRMCTIRMSFVKGWGAEYRRQTVTSTPCWIELHLNGPLQWLDKVLTQMGSPSIRCSSVS
No data.
No data.
Protein Tractability:
source: Open TargetsNo data.
PTM Intensity:
source: CPTACNo data.
PTM-Disease Association:
source: PTMDNo data.
PTM-Drug Perturbation Response:
source: DecryptMNo data.
Function score:
source: funscoRNo data.