Id: | acc0497 |
Group: | 1sens |
Protein: | PPARgamma |
Gene Symbol: | Pparg |
Protein Id: | P37238 |
Protein Name: | PPARG_MOUSE |
PTM: | phosphorylation |
Site: | Ser82 |
Site Sequence: | ISAPHYEDIPFTRADPMVADY |
Disease Category: | Cancer |
Disease: | Hepatocellular Carcinoma |
Disease Subtype: | |
Disease Cellline: | Hepa1-6 |
Disease Info: | |
Drug: | PD0325901 |
Drug Info: | "PD0325901 is a selective MEK1/MEK2 inhibitor that suppresses tumor cell proliferation by targeting the ERK signaling pathway, primarily used in preclinical research for its potential anticancer properties. " |
Relation: |
PD0325901
➜
PPARgamma-Ser82
DOWN
➜
Hepatocellular Carcinoma
Alleviate
|
Effect: | modulate |
Effect Info: | The MEK inhibitor PD0325901 can inhibit tumor growth by suppressing the phosphorylation of PPARgamma. |
Note: | |
Score: | 4.0 |
Pubmed(PMID): | 27769068 |
Sentence Index: | 27769068_0 |
Sentence: | Phosphorylation of PPARgamma at Ser84 promotes glycolysis and cell proliferation in hepatocellular carcinoma by targeting PFKFB4. |
Sequence & Structure:
MGETLGDSPVDPEHGAFADALPMSTSQEITMVDTEMPFWPTNFGISSVDLSVMEDHSHSFDIKPFTTVDFSSISAPHYEDIPFTRADPMVADYKYDLKLQEYQSAIKVEPASPPYYSEKTQLYNRPHEEPSNSLMAIECRVCGDKASGFHYGVHACEGCKGFFRRTIRLKLIYDRCDLNCRIHKKSRNKCQYCRFQKCLAVGMSHNAIRFGRMPQAEKEKLLAEISSDIDQLNPESADLRALAKHLYDSYIKSFPLTKAKARAILTGKTTDKSPFVIYDMNSLMMGEDKIKFKHITPLQEQSKEVAIRIFQGCQFRSVEAVQEITEYAKNIPGFINLDLNDQVTLLKYGVHEIIYTMLASLMNKDGVLISEGQGFMTREFLKNLRKPFGDFMEPKFEFAVKFNALELDDSDLAIFIAVIILSGDRPGLLNVKPIEDIQDNLLQALELQLKLNHPESSQLFAKVLQKMTDLRQIVTEHVQLLHVIKKTETDMSLHPLLQEIYKDLY
No data.
No data.
Protein Tractability:
source: Open TargetsNo data.
PTM Intensity:
source: CPTACNo data.
PTM-Disease Association:
source: PTMDResidue | Position | State | Disease | Class | PMID |
---|---|---|---|---|---|
- | - | D | Hypercholesterolemia | Acetylation | 36453279 |
- | - | D | Atherosclerosis | Acetylation | 36453279 |
S | 112 | D | Obesity | Phosphorylation | 18204460 |
S | 273 | U | Hepatitis | Phosphorylation | 30008738 |
State Note: Based on the distinct PTM states in diseases, PTMD classified all disease-associated PTMs into six classes, including whether the up-regulation (U) or down-regulation (D) of PTM levels, the absence (A) or presence (P) of PTMs, and the creation (C) or disruption (N) of PTM sites are associated with diseases.
PTM-Drug Perturbation Response:
source: DecryptMNo data.
Function score:
source: funscoRNo data.