Id: | acc0450 |
Group: | 1sens |
Protein: | Smad3 |
Gene Symbol: | SMAD3 |
Protein Id: | P84022 |
Protein Name: | SMAD3_HUMAN |
PTM: | phosphorylation |
Site: | Ser425 |
Site Sequence: | SPSIRCSSVS----------- |
Disease Category: | Cancer |
Disease: | Hepatocellular Carcinoma |
Disease Subtype: | |
Disease Cellline: | HCC |
Disease Info: | |
Drug: | Sorafenib |
Drug Info: | "Sorafenib is a multikinase inhibitor that targets Raf kinases, vascular endothelial growth factor receptors (VEGFR), platelet-derived growth factor receptor (PDGFR), and other kinases, primarily used in the treatment of advanced renal cell carcinoma, unresectable hepatocellular carcinoma, and radioactive iodine-refractory differentiated thyroid cancer." |
Relation: |
Smad3-Ser425
UP
+
Sorafenib
➜
Hepatocellular Carcinoma
Alleviate
|
Effect: | increase |
Effect Info: | LB - 100 sensitizes hepatocellular carcinoma cells to the effect of sorafenib under hypoxic conditions by activating Smad3 phosphorylation. |
Note: | |
Score: | 5.0 |
Pubmed(PMID): | 26666823 |
Sentence Index: | 26666823_0 |
Sentence: | LB-100 sensitizes hepatocellular carcinoma cells to the effects of sorafenib during hypoxia by activation of Smad3 phosphorylation. |
Sequence & Structure:
MSSILPFTPPIVKRLLGWKKGEQNGQEEKWCEKAVKSLVKKLKKTGQLDELEKAITTQNVNTKCITIPRSLDGRLQVSHRKGLPHVIYCRLWRWPDLHSHHELRAMELCEFAFNMKKDEVCVNPYHYQRVETPVLPPVLVPRHTEIPAEFPPLDDYSHSIPENTNFPAGIEPQSNIPETPPPGYLSEDGETSDHQMNHSMDAGSPNLSPNPMSPAHNNLDLQPVTYCEPAFWCSISYYELNQRVGETFHASQPSMTVDGFTDPSNSERFCLGLLSNVNRNAAVELTRRHIGRGVRLYYIGGEVFAECLSDSAIFVQSPNCNQRYGWHPATVCKIPPGCNLKIFNNQEFAALLAQSVNQGFEAVYQLTRMCTIRMSFVKGWGAEYRRQTVTSTPCWIELHLNGPLQWLDKVLTQMGSPSIRCSSVS
Select PDB:
No data.
Protein Tractability:
source: Open TargetsPTM Intensity:
source: CPTACNo data.
PTM-Disease Association:
source: PTMDResidue | Position | State | Disease | Class | PMID |
---|---|---|---|---|---|
K | 333 | D | Nonalcoholic steatohepatitis | Acetylation | 32305562 |
K | 341 | D | Renal fibrosis | Acetylation | 37777567 |
K | 378 | D | Nonalcoholic steatohepatitis | Acetylation | 32305562 |
K | 378 | D | Renal fibrosis | Acetylation | 37777567 |
K | 20 | U | Triple-negative breast cancer | Acetylation | 34392614 |
K | 117 | U | Triple-negative breast cancer | Acetylation | 34392614 |
K | 333 | U | Melanoma | Acetylation | 29520103 |
K | 53 | U | Cancer | Methylation | 35085106 |
K | 333 | U | Cancer | Methylation | 35085106 |
T | 179 | U | Breast cancer | Phosphorylation | 33051597 |
S | 213 | U | Prostate cancer | Phosphorylation | 36536346 |
State Note: Based on the distinct PTM states in diseases, PTMD classified all disease-associated PTMs into six classes, including whether the up-regulation (U) or down-regulation (D) of PTM levels, the absence (A) or presence (P) of PTMs, and the creation (C) or disruption (N) of PTM sites are associated with diseases.
PTM-Drug Perturbation Response:
source: DecryptMNo data.
Function score:
source: funscoRNo data.