Id: | acc0168 |
Group: | 1sens |
Protein: | H2AX |
Gene Symbol: | H2AX |
Protein Id: | P16104 |
Protein Name: | H2AX_HUMAN |
PTM: | phosphorylation |
Site: | Ser139 |
Site Sequence: | PSGGKKATQASQEY------- |
Disease Category: | Cancer |
Disease: | Leukemia |
Disease Subtype: | ALL |
Disease Cellline: | |
Disease Info: | |
Drug: | Mitoxantrone |
Drug Info: | "Mitoxantrone is a synthetic anthracycline-derived antineoplastic agent that inhibits DNA and RNA synthesis by intercalating into DNA, inhibiting topoisomerase II, and disrupting cell cycle progression, primarily used in the treatment of malignant lymphoma, breast cancer, acute leukemia, and various solid tumors." |
Relation: |
Mitoxantrone
➜
Leukemia
Alleviate
+
H2AX-Ser139
UP
|
Effect: | modulate |
Effect Info: | Protein phosphorylation increases after drug treatment. |
Note: | histone |
Score: | 3.0 |
Pubmed(PMID): | 19411853 |
Sentence Index: | 19411853_4 |
Sentence: | "We have measured DDR as reported by activation of ATM through its phosphorylation on Ser 1981 (ATM-S1981(P)) concurrent with histone H2AX phosphorylation on Ser139 (gammaH2AX) in leukemic blast cells from the blood of twenty patients, 16 children/adolescents and 4 adults, diagnosed with acute leukemias and treated with topo2 inhibitors doxorubicin, daunomycin, mitoxantrone or idarubicin." |
Sequence & Structure:
MSGRGKTGGKARAKAKSRSSRAGLQFPVGRVHRLLRKGHYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGGVTIAQGGVLPNIQAVLLPKKTSATVGPKAPSGGKKATQASQEY
Select PDB:
No data.
Protein Tractability:
source: Open TargetsPTM Intensity:
source: CPTACNo data.
PTM-Disease Association:
source: PTMDResidue | Position | State | Disease | Class | PMID |
---|---|---|---|---|---|
S | 139 | U | Acute myelogenous leukemia | Phosphorylation | 33691101 |
S | 139 | U | Hepatocellular carcinoma | Phosphorylation | 25537504 |
S | 139 | U | Multiple myeloma | Phosphorylation | 35190641 |
State Note: Based on the distinct PTM states in diseases, PTMD classified all disease-associated PTMs into six classes, including whether the up-regulation (U) or down-regulation (D) of PTM levels, the absence (A) or presence (P) of PTMs, and the creation (C) or disruption (N) of PTM sites are associated with diseases.
PTM-Drug Perturbation Response:
source: DecryptMNo data.
Function score:
source: funscoRNo data.