Id: | acc0166 |
Group: | 1sens |
Protein: | H2AX |
Gene Symbol: | H2AX |
Protein Id: | P16104 |
Protein Name: | H2AX_HUMAN |
PTM: | phosphorylation |
Site: | Ser139 |
Site Sequence: | PSGGKKATQASQEY------- |
Disease Category: | Cancer |
Disease: | Leukemia |
Disease Subtype: | ALL |
Disease Cellline: | |
Disease Info: | |
Drug: | Daunomycin |
Drug Info: | "Daunomycin is an anthracycline antibiotic used in chemotherapy, primarily for treating acute leukemias, by inhibiting DNA and RNA synthesis through intercalation and topoisomerase II inhibition. " |
Relation: |
Daunomycin
➜
Leukemia
Alleviate
+
H2AX-Ser139
UP
|
Effect: | modulate |
Effect Info: | Protein phosphorylation increased after drug treatment. |
Note: | histone |
Score: | 3.0 |
Pubmed(PMID): | 19411853 |
Sentence Index: | 19411853_4 |
Sentence: | "We have measured DDR as reported by activation of ATM through its phosphorylation on Ser 1981 (ATM-S1981(P)) concurrent with histone H2AX phosphorylation on Ser139 (gammaH2AX) in leukemic blast cells from the blood of twenty patients, 16 children/adolescents and 4 adults, diagnosed with acute leukemias and treated with topo2 inhibitors doxorubicin, daunomycin, mitoxantrone or idarubicin." |
Sequence & Structure:
MSGRGKTGGKARAKAKSRSSRAGLQFPVGRVHRLLRKGHYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGGVTIAQGGVLPNIQAVLLPKKTSATVGPKAPSGGKKATQASQEY
Select PDB:
No data.
Protein Tractability:
source: Open TargetsPTM Intensity:
source: CPTACNo data.
PTM-Disease Association:
source: PTMDResidue | Position | State | Disease | Class | PMID |
---|---|---|---|---|---|
S | 139 | U | Acute myelogenous leukemia | Phosphorylation | 33691101 |
S | 139 | U | Hepatocellular carcinoma | Phosphorylation | 25537504 |
S | 139 | U | Multiple myeloma | Phosphorylation | 35190641 |
State Note: Based on the distinct PTM states in diseases, PTMD classified all disease-associated PTMs into six classes, including whether the up-regulation (U) or down-regulation (D) of PTM levels, the absence (A) or presence (P) of PTMs, and the creation (C) or disruption (N) of PTM sites are associated with diseases.
PTM-Drug Perturbation Response:
source: DecryptMNo data.
Function score:
source: funscoRNo data.