Id: | acc0155 |
Group: | 1sens |
Protein: | Smad3 |
Gene Symbol: | SMAD3 |
Protein Id: | P84022 |
Protein Name: | SMAD3_HUMAN |
PTM: | phosphorylation |
Site: | Ser425 |
Site Sequence: | SPSIRCSSVS----------- |
Disease Category: | Cancer |
Disease: | Renal Cancer |
Disease Subtype: | |
Disease Cellline: | FU-UR-1 |
Disease Info: | |
Drug: | Halofuginone |
Drug Info: | "Halofuginone is a synthetic quinazolinone derivative with antiprotozoal (anticoccidial) and antifibrotic activities, functioning as a competitive inhibitor of prolyl-tRNA synthetase and inhibitor of type I collagen synthesis, primarily used in veterinary medicine for poultry coccidiosis prevention and investigated for therapeutic potential in fibrotic disorders. " |
Relation: |
Halofuginone
➜
Smad3-Ser425
DOWN
➜
Renal Cancer
Alleviate
|
Effect: | modulate |
Effect Info: | Halofuginone is an inhibitor of myofibroblast activation and Smad3 phosphorylation. It can inhibit the development of tumors in xenografts produced by renal cancer cells carrying the ASPL-TFE3 reciprocal fusion transcript. |
Note: | |
Score: | 4.0 |
Pubmed(PMID): | 18714394 |
Sentence Index: | 18714394_9 |
Sentence: | "Halofuginone, an inhibitor of myofibroblasts' activation and Smad3 phosphorylation, inhibited tumor development in xenografts derived from renal carcinoma cells harboring a reciprocal ASPL-TFE3 fusion transcript." |
Sequence & Structure:
MSSILPFTPPIVKRLLGWKKGEQNGQEEKWCEKAVKSLVKKLKKTGQLDELEKAITTQNVNTKCITIPRSLDGRLQVSHRKGLPHVIYCRLWRWPDLHSHHELRAMELCEFAFNMKKDEVCVNPYHYQRVETPVLPPVLVPRHTEIPAEFPPLDDYSHSIPENTNFPAGIEPQSNIPETPPPGYLSEDGETSDHQMNHSMDAGSPNLSPNPMSPAHNNLDLQPVTYCEPAFWCSISYYELNQRVGETFHASQPSMTVDGFTDPSNSERFCLGLLSNVNRNAAVELTRRHIGRGVRLYYIGGEVFAECLSDSAIFVQSPNCNQRYGWHPATVCKIPPGCNLKIFNNQEFAALLAQSVNQGFEAVYQLTRMCTIRMSFVKGWGAEYRRQTVTSTPCWIELHLNGPLQWLDKVLTQMGSPSIRCSSVS
Select PDB:
No data.
Protein Tractability:
source: Open TargetsPTM Intensity:
source: CPTACNo data.
PTM-Disease Association:
source: PTMDResidue | Position | State | Disease | Class | PMID |
---|---|---|---|---|---|
K | 333 | D | Nonalcoholic steatohepatitis | Acetylation | 32305562 |
K | 341 | D | Renal fibrosis | Acetylation | 37777567 |
K | 378 | D | Nonalcoholic steatohepatitis | Acetylation | 32305562 |
K | 378 | D | Renal fibrosis | Acetylation | 37777567 |
K | 20 | U | Triple-negative breast cancer | Acetylation | 34392614 |
K | 117 | U | Triple-negative breast cancer | Acetylation | 34392614 |
K | 333 | U | Melanoma | Acetylation | 29520103 |
K | 53 | U | Cancer | Methylation | 35085106 |
K | 333 | U | Cancer | Methylation | 35085106 |
T | 179 | U | Breast cancer | Phosphorylation | 33051597 |
S | 213 | U | Prostate cancer | Phosphorylation | 36536346 |
State Note: Based on the distinct PTM states in diseases, PTMD classified all disease-associated PTMs into six classes, including whether the up-regulation (U) or down-regulation (D) of PTM levels, the absence (A) or presence (P) of PTMs, and the creation (C) or disruption (N) of PTM sites are associated with diseases.
PTM-Drug Perturbation Response:
source: DecryptMNo data.
Function score:
source: funscoRNo data.