Id: acc0066
Group: 1sens
Protein: ATF4
Gene Symbol: ATF4
Protein Id: P18848
Protein Name: ATF4_HUMAN
PTM: phosphorylation
Site: unclear
Site Sequence:
Disease Category: Cancer
Disease: Glioblastoma
Disease Subtype:
Disease Cellline: GBM
Disease Info:
Drug: Luteolin
Drug Info: "Luteolin is a naturally occurring flavonoid found in various plants, which exhibits anti-inflammatory, antioxidant, and potential anticancer properties, and is currently under investigation for its therapeutic applications in neurodegenerative diseases and cancer."
Relation:
Luteolin
ATF4-unclear UP
Glioblastoma Alleviate
Effect: modulate
Effect Info: "Luteolin activates the phosphorylation of eIF2alpha, PERK, CHOP, ATF4 and cleaved caspases, thereby inhibiting tumors."
Note:
Score: 4.0
Pubmed(PMID): 30798142
Sentence Index:
Sentence:

Sequence & Structure:

MTEMSFLSSEVLVGDLMSPFDQSGLGAEESLGLLDDYLEVAKHFKPHGFSSDKAKAGSSEWLAVDGLVSPSNNSKEDAFSGTDWMLEKMDLKEFDLDALLGIDDLETMPDDLLTTLDDTCDLFAPLVQETNKQPPQTVNPIGHLPESLTKPDQVAPFTFLQPLPLSPGVLSSTPDHSFSLELGSEVDITEGDRKPDYTAYVAMIPQCIKEEDTPSDNDSGICMSPESYLGSPQHSPSTRGSPNRSLPSPGVLCGSARPKPYDPPGEKMVAAKVKGEKLDKKLKKMEQNKTAATRYRQKKRAEQEALTGECKELEKKNEALKERADSLAKEIQYLKDLIEEVRKARGKKRVP

Select PDB:

Known Drugs:

source: Multi-Sources

(see table)

No data.

Protein Tractability:

source: Open Targets
Small molecule
Antibody
PROTAC
Other modalities
Approved Drug
Advanced Clinical
Phase 1 Clinical
Structure with Ligand
High-Quality Ligand
High-Quality Pocket
Med-Quality Pocket
Druggable Family
Approved Drug
Advanced Clinical
Phase 1 Clinical
UniProt loc high conf
GO CC high conf
UniProt loc med conf
UniProt SigP or TMHMM
GO CC med conf
Human Protein Atlas loc
Approved Drug
Advanced Clinical
Phase 1 Clinical
Literature
UniProt Ubiquitination
Database Ubiquitination
Half-life Data
Small Molecule Binder
Approved Drug
Advanced Clinical
Phase 1 Clinical

PTM Intensity:

source: CPTAC

No data.

PTM-Disease Association:

source: PTMD
Residue Position State Disease Class PMID
S 245 P Coffin-Lowry syndrome Phosphorylation 15109498
S 245 U Breast cancer/tumor/carcinoma Phosphorylation 22052162
S 245 U Non-small cell lung cancer/carcinoma Phosphorylation 23975372

State Note: Based on the distinct PTM states in diseases, PTMD classified all disease-associated PTMs into six classes, including whether the up-regulation (U) or down-regulation (D) of PTM levels, the absence (A) or presence (P) of PTMs, and the creation (C) or disruption (N) of PTM sites are associated with diseases.

PTM-Drug Perturbation Response:

source: DecryptM

No data.

Function score:

source: funscoR

No data.

Cross Links: