Id: | acc0032 |
Group: | 1sens |
Protein: | FGFR3 hisone H4 |
Gene Symbol: | H4C1 |
Protein Id: | P62805 |
Protein Name: | H4_HUMAN |
PTM: | methylation |
Site: | Arg3 |
Site Sequence: | -------MSGRGKGGKGLGKG |
Disease Category: | Cancer |
Disease: | Colorectal Cancer |
Disease Subtype: | |
Disease Cellline: | HCT116 |
Disease Info: | |
Drug: | PRMT5 KO |
Drug Info: | - |
Relation: |
PRMT5 KO
➜
FGFR3 hisone H4-Arg3
UP
➜
Colorectal Cancer
Alleviate
|
Effect: | modulate |
Effect Info: | Knockdown of AMI-1 or inhibition of PRMT5 leads to the downregulation of FGFR3 and eIF4E to inhibit colorectal cancer. PRMT5 regulates the methylation of H3R8 and H4R3 on the FGFR3 and eIF4E promoters. |
Note: | "histone, Non-conventional drugs" |
Score: | 3.0 |
Pubmed(PMID): | 26078354 |
Sentence Index: | 26078354_0 |
Sentence: | Targeting protein arginine methyltransferase 5 inhibits colorectal cancer growth by decreasing arginine methylation of eIF4E and FGFR3. |
Sequence & Structure:
MSGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG
Select PDB:
No data.
Protein Tractability:
source: Open TargetsNo data.
PTM Intensity:
source: CPTACNo data.
PTM-Disease Association:
source: PTMDResidue | Position | State | Disease | Class | PMID |
---|---|---|---|---|---|
R | 3 | U | Esophageal carcinoma | Acetylation | 20142251 |
State Note: Based on the distinct PTM states in diseases, PTMD classified all disease-associated PTMs into six classes, including whether the up-regulation (U) or down-regulation (D) of PTM levels, the absence (A) or presence (P) of PTMs, and the creation (C) or disruption (N) of PTM sites are associated with diseases.
PTM-Drug Perturbation Response:
source: DecryptMNo data.
Function score:
source: funscoRNo data.