Id: | acc0026 |
Group: | 1sens |
Protein: | histone H3 |
Gene Symbol: | H3C1 |
Protein Id: | P68431 |
Protein Name: | H31_HUMAN |
PTM: | methylation |
Site: | Lys9 |
Site Sequence: | -MARTKQTARKSTGGKAPRKQ |
Disease Category: | Cancer |
Disease: | Leukemia |
Disease Subtype: | Erythroleukemia |
Disease Cellline: | KG1a |
Disease Info: | |
Drug: | 5-aza-2'-deoxycytidine |
Drug Info: | "5-Aza-2'-deoxycytidine (Decitabine) is a DNA methyltransferase inhibitor that induces DNA hypomethylation and reactivates silenced genes, primarily used in the treatment of myelodysplastic syndromes (MDS) and other hematologic malignancies." |
Relation: |
5-aza-2'-deoxycytidine
➜
histone H3-Lys9
DOWN
➜
Leukemia
Alleviate
|
Effect: | modulate |
Effect Info: | 5-aza-2'-deoxycytidine reduces histone methylation |
Note: | histone |
Score: | 3.0 |
Pubmed(PMID): | 19881540 |
Sentence Index: | 19881540_2 |
Sentence: | "In support of this model, we found in acute myeloid leukemia cells with hypermethylated p15INK4B and E-cadherin promoters that the DNMT inhibitor, 5-aza-2'-deoxycytidine, induced p15INK4B and E-cadherin expression, and decreased levels of DNA methylation, histone H3 lysine 9 (H3K9) methylation and SUV39H1 associated with p15INK4B and E-cadherin promoters." |
Sequence & Structure:
MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
Select PDB:
No data.
Protein Tractability:
source: Open TargetsNo data.
PTM Intensity:
source: CPTACNo data.
PTM-Disease Association:
source: PTMDResidue | Position | State | Disease | Class | PMID |
---|---|---|---|---|---|
K | 9 | D | Diabetes mellitus | Acetylation | 23423566 |
K | 9 | D | Friedreich's ataxia | Acetylation | 18045775 |
K | 9 | D | Prostate cancer | Acetylation | 19885564 |
K | 9 | D | Systemic lupus erythematosus | Acetylation | 36165173 |
K | 9 | D | Prostate cancer | Methylation | 19739128 |
K | 9 | D | Pancreatic carcinoma | Methylation | 20142597 |
K | 9 | U | Prostate cancer | Acetylation | 19935671 |
K | 9 | U | Diabetes mellitus | Acetylation | 23423566 |
K | 9 | U | Gastric adenocarcinoma | Acetylation | 18470569 |
K | 9 | U | Type 2 diabetes | Acetylation | 34944721 |
K | 9 | U | Breast cancer | Methylation | 19943104 |
K | 9 | U | Friedreich's ataxia | Methylation | 18045775 |
K | 9 | U | Friedreich's ataxia | Methylation | 18045775 |
State Note: Based on the distinct PTM states in diseases, PTMD classified all disease-associated PTMs into six classes, including whether the up-regulation (U) or down-regulation (D) of PTM levels, the absence (A) or presence (P) of PTMs, and the creation (C) or disruption (N) of PTM sites are associated with diseases.
PTM-Drug Perturbation Response:
source: DecryptMNo data.
Function score:
source: funscoRNo data.