Id: acc0010
Group: 1sens
Protein: PVT1 H4
Gene Symbol: H4C1
Protein Id: P62805
Protein Name: H4_HUMAN
PTM: acetylation
Site: unclear
Site Sequence:
Disease Category: Cancer
Disease: Pancreas Cancer
Disease Subtype: PDAC
Disease Cellline: PANC-1
Disease Info:
Drug: Gemcitabine
Drug Info: "Gemcitabine is a pyrimidine nucleoside analog antimetabolite and antineoplastic agent that inhibits DNA synthesis and repair, leading to autophagy and apoptosis, and is used in the treatment of various solid tumors including non-small cell lung cancer, pancreatic cancer, breast cancer, and ovarian cancer. "
Relation:
Gemcitabine
PVT1 H4-unclear UP
Pancreas Cancer Aggravate
Effect: modulate
Effect Info: Histone acetyltransferase 1 promotes the development of gemcitabine resistance by regulating the PVT1/EZH2 complex in pancreatic cancer.
Note: histone
Score: 3.0
Pubmed(PMID): 34564701
Sentence Index:
Sentence:

Sequence & Structure:

MSGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG

Select PDB:

Known Drugs:

source: Multi-Sources

(see table)

No data.

Protein Tractability:

source: Open Targets

No data.

PTM Intensity:

source: CPTAC

No data.

PTM-Disease Association:

source: PTMD
Residue Position State Disease Class PMID
K 16 A Colorectal carcinoma Acetylation 15765097
K 16 A Lymphoma Acetylation 15765097
K 16 A Squamous cell carcinoma Acetylation 15765097
K 12 D Friedreich's ataxia Acetylation 18045775
K 16 D Fragile X syndrome Methylation 18628788
K 12 D Fragile X syndrome Methylation 18628788
K 8 D Fragile X syndrome Methylation 18628788
K 5 D Fragile X syndrome Methylation 18628788
K 16 D Ovarian cancer Acetylation 28866885
K 16 D Friedreich's ataxia Acetylation 18045775
K 16 D Clear cell kidney cancer Acetylation 23394073
K 12 D Non-small cell lung cancer Methylation 18974389
K 16 D Non-small cell lung cancer Methylation 18974389
K 12 D Ovarian cancer Acetylation 28866885
K 12 D Impaired spermatogenesis Acetylation 18001726
K 12 D Breast cancer Acetylation 21146603
K 20 D Non-small cell lung cancer Methylation 18974389
K 8 D Friedreich's ataxia Acetylation 18045775
K 8 D Breast cancer Acetylation 21146603
K 20 D Ovarian cancer Methylation 20053926
K 5 D Friedreich's ataxia Acetylation 18045775
K 16 D Alzheimer's disease Acetylation 32973937
K 16 D Squamous cell carcinoma Acetylation 15765097
K 16 D Lymphoma Acetylation 15765097
K 16 D Colorectal carcinoma Acetylation 15765097
Y 88 U Breast cancer Phosphorylation 37330596
K 8 U Non-small cell lung cancer Methylation 18974389
K 5 U Non-small cell lung cancer Methylation 18974389
K 20 U Prostate cancer Methylation 19935671
K 16 U Systemic lupus erythematosus Acetylation 17530637 25611806
K 12 U Systemic lupus erythematosus Acetylation 17530637 25611806
K 12 U Colorectal cancer Acetylation 19057998
K 8 U Systemic lupus erythematosus Acetylation 17530637 25611806
K 5 U Systemic lupus erythematosus Acetylation 25611806
R 3 U Esophageal carcinoma Acetylation 20142251

State Note: Based on the distinct PTM states in diseases, PTMD classified all disease-associated PTMs into six classes, including whether the up-regulation (U) or down-regulation (D) of PTM levels, the absence (A) or presence (P) of PTMs, and the creation (C) or disruption (N) of PTM sites are associated with diseases.

PTM-Drug Perturbation Response:

source: DecryptM

No data.

Function score:

source: funscoR

No data.

Cross Links: