Id: | acc0007 |
Group: | 1sens |
Protein: | c-Jun |
Gene Symbol: | JUN |
Protein Id: | P05412 |
Protein Name: | JUN_HUMAN |
PTM: | acetylation |
Site: | unclear |
Site Sequence: | |
Disease Category: | Cancer |
Disease: | Skin Cancer |
Disease Subtype: | SCC |
Disease Cellline: | SCC12 |
Disease Info: | |
Drug: | Ginsenoside Rg3 |
Drug Info: | "Ginsenoside Rg3 is a rare triterpenoid saponin derived from Panax ginseng, clinically utilized as an adjunctive therapeutic agent to enhance chemotherapy efficacy in primary lung and liver cancers by inhibiting tumor angiogenesis, suppressing tumor cell proliferation and metastasis, and improving immune function. " |
Relation: |
Ginsenoside Rg3
➜
c-Jun-unclear
UP
➜
Skin Cancer
Alleviate
|
Effect: | modulate |
Effect Info: | The drug promotes the acetylation of c-Jun to de - inhibit the epithelial - mesenchymal transition of cutaneous squamous cell carcinoma. |
Note: | |
Score: | 4.0 |
Pubmed(PMID): | 31192452 |
Sentence Index: | 31192452_0 |
Sentence: | Downregulation of HDAC3 by ginsenoside Rg3 inhibits epithelial-mesenchymal transition of cutaneous squamous cell carcinoma through c-Jun acetylation. |
Sequence & Structure:
MTAKMETTFYDDALNASFLPSESGPYGYSNPKILKQSMTLNLADPVGSLKPHLRAKNSDLLTSPDVGLLKLASPELERLIIQSSNGHITTTPTPTQFLCPKNVTDEQEGFAEGFVRALAELHSQNTLPSVTSAAQPVNGAGMVAPAVASVAGGSGSGGFSASLHSEPPVYANLSNFNPGALSSGGGAPSYGAAGLAFPAQPQQQQQPPHHLPQQMPVQHPRLQALKEEPQTVPEMPGETPPLSPIDMESQERIKAERKRMRNRIAASKCRKRKLERIARLEEKVKTLKAQNSELASTANMLREQVAQLKQKVMNHVNSGCQLMLTQQLQTF
Select PDB:
No data.
Protein Tractability:
source: Open TargetsPTM Intensity:
source: CPTACNo intensity data of this site,
show all other sites!
JUNB-Lys240 | |||||
---|---|---|---|---|---|
Cancer | Intensity | ||||
BRCA | -1.141 | ||||
COAD | |||||
HGSC | |||||
ccRCC | |||||
GBM | |||||
HNSC | |||||
LUAD | 0.726 | ||||
LUSC | 0.415 | ||||
non_ccRCC | |||||
PDAC | |||||
UCEC |
JUNB-Lys284 | |||||
---|---|---|---|---|---|
Cancer | Intensity | ||||
BRCA | -0.707 | ||||
COAD | |||||
HGSC | |||||
ccRCC | |||||
GBM | |||||
HNSC | |||||
LUAD | |||||
LUSC | 0.707 | ||||
non_ccRCC | |||||
PDAC | |||||
UCEC |
JUNB-Lys36 | |
---|---|
Cancer | Intensity |
BRCA | 0.085 |
COAD | |
HGSC | |
ccRCC | |
GBM | |
HNSC | |
LUAD | -1.04 |
LUSC | 0.955 |
non_ccRCC | |
PDAC | |
UCEC |
PTM-Disease Association:
source: PTMDResidue | Position | State | Disease | Class | PMID |
---|---|---|---|---|---|
- | - | D | Airway fibrosis | Acetylation | 34011384 |
- | - | P | Myeloma | Phosphorylation | 23175437 |
- | - | U | Airway fibrosis | Acetylation | 34011384 |
- | - | U | Osteogenic sarcoma/osteosarcoma | Phosphorylation | 24025361 |
State Note: Based on the distinct PTM states in diseases, PTMD classified all disease-associated PTMs into six classes, including whether the up-regulation (U) or down-regulation (D) of PTM levels, the absence (A) or presence (P) of PTMs, and the creation (C) or disruption (N) of PTM sites are associated with diseases.
PTM-Drug Perturbation Response:
source: DecryptMNo data.
Function score:
source: funscoRNo data.